KEGG   Bacillus megaterium DSM 319: BMD_1940Help
Entry
BMD_1940          CDS       T01219                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BMD_1940
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BMD_1940
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BMD_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1942606..1943082
Genome map
AA seq 158 aa AA seqDB search
MSVYEYSAKTIKDEDVSLSNYQGDVLLIVNTASKCGFTPQYKDLQALYEEEKENGLTVLG
FPCNQFGGQEPGSSNDIEQFCELNYGVSFPMFAKVDVKGEHAHPLFTYLAEQAPGLLGSK
GIKWNFTKFLVNRQGEVVKRYAPQTAPKDIQKDIKELL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgtatgaatactctgcaaaaacaattaaagacgaagacgtatcgctatctaac
tatcaaggtgacgtactgttgattgtgaatacagctagcaaatgcggcttcacccctcaa
tataaagatttgcaggcgctgtacgaagaagaaaaagaaaatggcctaacggttctaggt
tttccttgcaatcagttcggtggtcaagagccaggaagttcaaacgatattgaacaattt
tgtgagttaaactatggcgtttcgtttccgatgtttgcaaaagtagatgtaaaaggggag
cacgcacacccgttatttacatacttagcagaacaagcaccgggcctgctaggttccaaa
gggataaaatggaattttacaaagtttttagtgaatcgtcaaggtgaagtcgtgaagcga
tacgcacctcaaactgcaccaaaagatattcaaaaagatataaaagaattgctgtaa

DBGET integrated database retrieval system