KEGG   Bacillus megaterium DSM 319: BMD_2214Help
Entry
BMD_2214          CDS       T01219                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2208496..2209479
Genome map
AA seq 327 aa AA seqDB search
MPKYQPKNSFESPRFCGPRTFMRLPYVEQVNSDMDFIITGIPFDSGQSFRTGARFGPEAI
RDFSILLRPYNPEQKINIFDYISGVDYGDLSVVPGYILETYKKIEEGLTPVVNEGIIPIS
LGGDHSMTLGELRAIAKKHGPVALLQFDAHSDTWDSYFEQKYNHGTVFRRAIEEGLIDVS
RSIQIGMRGGLYGIEDLEDAKNLGLALYTTNEYKKLGVERMLEIIHERVGEGPVFLSFDI
DFLDPVYAPGTGTPEVSGASIDDALQFVRGLTNIDFVGFDLVEVLPAYDHGQITAAGAAN
IVYEFITLIALRKKAKEEEALLVKARD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaatatcagccgaaaaattcatttgaatctccgcgtttttgcggacctcgaacg
tttatgagacttccgtatgtagaacaagtaaattcagatatggattttattatcacgggt
attccatttgattcagggcagtcttttcgcacaggagcacgttttgggccggaagctatt
cgagatttctccattttgcttcgcccgtataacccagaacaaaagattaatatttttgat
tacatttcaggtgtggactacggtgatttgtcagtggttccgggatatattttagaaacg
tataaaaaaattgaagaagggttaacgccggttgtgaatgaaggaattattcctatttca
ctaggaggcgatcattcgatgacgcttggtgaacttcgtgcgattgcgaaaaaacacgga
ccggtagcgcttttacagtttgatgctcattctgatacgtgggatagttattttgaacaa
aaatacaatcacggtacggtattcagacgagcgattgaagaagggttaatcgacgtgtcg
cgctcgattcaaatcggtatgcgaggcgggctgtacggcattgaagatttagaagatgca
aagaacttaggtctagctctgtatacgacaaatgaatataaaaaactgggcgttgaaaga
atgctagaaattattcatgagcgtgtaggagaaggacccgtatttttgtcgtttgacatt
gactttttagatccagtttacgcgccgggaacaggaacgcctgaagtatcgggtgcaagt
attgacgatgcgcttcaattcgttcggggcttaacaaatatagattttgtcggttttgat
ttagtggaagtactgccagcttatgatcatggtcaaattacagcagcgggggccgctaac
attgtctatgaatttattacgcttattgcgttaagaaaaaaagcaaaagaagaagaagcg
ctgttagtgaaagcacgcgactaa

DBGET integrated database retrieval system