KEGG   Bacillus megaterium DSM 319: BMD_2911Help
Entry
BMD_2911          CDS       T01219                                 

Definition
(GenBank) monoacylglycerol lipase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
bmd  Bacillus megaterium DSM 319
Brite
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BMD_2911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 Abhydrolase_6 BAAT_C DLH Abhydrolase_3 Say1_Mug180 DUF3141
Motif
Other DBs
NCBI-ProteinID: ADF39752
UniProt: D5DHR4
Position
complement(2884363..2885136)
Genome map
AA seq 257 aa AA seqDB search
MERYDVIQGAESFYYKGNDIGILVSHGFMGTPQSMEYIGKELAEKGFTVYGLRLTGHGTH
YYDIEQTTYQKWKQDFLTGYQRLKQECRHVFILGQSMGGTLTFHTASQGLDLDGVIAINP
AITSIPSMEPYRSRHTPRYLKEEHPDIKDPNVHEITYDKVPVRSMRELLSLMDETKERLS
YVTCPALVLTSTVDNVVPPENSAYILNHIQSAEKRQHMLRNSYHVASMDFDKDTIVAQTA
QFVQATVAKKKVHERIF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatgacgtaattcaaggcgcagaatctttttattataaaggcaacgacatt
ggtatacttgtttctcatggatttatggggactcctcaaagtatggaatatatcggaaaa
gaattagctgaaaaaggttttactgtgtacggtttgcgactaacgggacatggtactcac
tactatgatattgaacaaacaacgtaccagaaatggaagcaagactttttaactgggtat
cagcgtttgaagcaagaatgccgtcatgtatttatcttgggtcagtccatgggaggcact
cttacctttcatacagcaagccaaggattagaccttgacggagttattgcaatcaatccg
gctataacgtccattccttcaatggagccttatcgctctcgtcatacgcctcgttattta
aaagaagagcatcctgatattaaagatccaaacgtacatgaaattacgtacgataaagta
cccgtgcgctctatgcgtgagctgctttctttaatggacgaaacaaaagaacgcttatct
tatgtaacgtgccctgctttagtactaacatcaacagttgataacgtagtaccgcctgag
aattcagcttatatcttaaaccatattcaatcagcagaaaaaagacagcacatgcttcga
aactcttaccatgttgcgtcaatggattttgataaagacacaattgttgcacaaacggca
cagtttgtacaagcaacagttgccaaaaaaaaagtacatgagcgaattttttaa

DBGET integrated database retrieval system