KEGG   Bacillus megaterium DSM 319: BMD_2911Help
Entry
BMD_2911          CDS       T01219                                 

Definition
monoacylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bmd  Bacillus megaterium DSM 319
Brite
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BMD_2911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2884363..2885136)
Genome map
AA seq 257 aa AA seqDB search
MERYDVIQGAESFYYKGNDIGILVSHGFMGTPQSMEYIGKELAEKGFTVYGLRLTGHGTH
YYDIEQTTYQKWKQDFLTGYQRLKQECRHVFILGQSMGGTLTFHTASQGLDLDGVIAINP
AITSIPSMEPYRSRHTPRYLKEEHPDIKDPNVHEITYDKVPVRSMRELLSLMDETKERLS
YVTCPALVLTSTVDNVVPPENSAYILNHIQSAEKRQHMLRNSYHVASMDFDKDTIVAQTA
QFVQATVAKKKVHERIF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatgacgtaattcaaggcgcagaatctttttattataaaggcaacgacatt
ggtatacttgtttctcatggatttatggggactcctcaaagtatggaatatatcggaaaa
gaattagctgaaaaaggttttactgtgtacggtttgcgactaacgggacatggtactcac
tactatgatattgaacaaacaacgtaccagaaatggaagcaagactttttaactgggtat
cagcgtttgaagcaagaatgccgtcatgtatttatcttgggtcagtccatgggaggcact
cttacctttcatacagcaagccaaggattagaccttgacggagttattgcaatcaatccg
gctataacgtccattccttcaatggagccttatcgctctcgtcatacgcctcgttattta
aaagaagagcatcctgatattaaagatccaaacgtacatgaaattacgtacgataaagta
cccgtgcgctctatgcgtgagctgctttctttaatggacgaaacaaaagaacgcttatct
tatgtaacgtgccctgctttagtactaacatcaacagttgataacgtagtaccgcctgag
aattcagcttatatcttaaaccatattcaatcagcagaaaaaagacagcacatgcttcga
aactcttaccatgttgcgtcaatggattttgataaagacacaattgttgcacaaacggca
cagtttgtacaagcaacagttgccaaaaaaaaagtacatgagcgaattttttaa

DBGET integrated database retrieval system