KEGG   Bacillus megaterium DSM 319: BMD_2925Help
Entry
BMD_2925          CDS       T01219                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMD_2925 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMD_2925 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BMD_2925 (odhB)
Enzymes [BR:bmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMD_2925 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2899763..2901058)
Genome map
AA seq 431 aa AA seqDB search
MGEIKVPELAESISEGTVAQWLKQVGDFVEKGDYIVELETDKVNVEITAEDSGVLTELLA
GEGDTVQVGETIARLEAKEGASAPAAPKAEEKQAEEAPKQEAAPAQQKTVEEVAPAAEAP
QQGNQKQWLIASPAARKAARERGIKLDQVPTTDPLGRVRKHDIDSYADQKSNEQKQQAQA
SKPANPVSPSPAASENSDKPVERERMSRRRQTIAKRLVEVQQTAAMLTTFNEVDMTAVMA
LRKRRKDKFFEQHDVRLGFMSFFTKAVVAALKKYPLLNAEIQGNELLIKKFYDIGIAVSA
PDGLVVPVVRDADRKTFAGIEGSIVDLAKKARDNKLALKDLQGGTFTITNGGVFGSLMST
PILNGPQVGILGMHKVQLRPVAIDEERIENRPMMYIALSYDHRIVDGKEAVSFLATVKEL
LEDPESLLLEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggagagattaaagtaccggaattagcagaatcaatttctgaaggaacagttgcacag
tggctaaaacaagtaggagatttcgttgaaaaaggcgattatatcgttgaacttgaaaca
gataaagttaacgttgaaattacagctgaagactctggtgtgttaacggaacttcttgct
ggcgaaggagacacagtgcaagttggtgaaacaattgcacgtcttgaagcgaaagaagga
gcttcagcaccagcagcaccaaaagctgaagaaaaacaagcagaggaagcaccaaagcaa
gaagcggctccagctcagcaaaaaactgttgaagaagtagcgccagcagctgaagcgcct
cagcaaggaaatcaaaaacaatggctaattgcttctcctgcagctcgcaaagcagcaaga
gaacgcgggattaagctagatcaagtgccaactactgatcctcttggccgtgtgcgcaaa
catgatattgattcgtatgcagaccaaaaatcaaatgagcaaaagcagcaggcacaagca
agtaagccagctaacccggtatctccgtctccagcggcaagtgaaaatagcgacaaacct
gttgaacgcgaacgtatgtcacgtcgtcgtcaaacaattgccaaacgtctcgttgaagtt
cagcaaacagcggctatgctaacaacgtttaacgaagtagacatgactgctgttatggct
cttcgcaaacgacgcaaagacaaattctttgaacagcacgacgtaagactgggctttatg
tcattctttacaaaagcagtagtagcagcacttaaaaagtatccattattaaatgctgaa
attcaaggaaacgagttattaattaagaaattctatgatatcggtattgctgtgtcagct
ccagacggtcttgttgttccagttgtacgtgatgctgaccgcaaaacattcgctggtatc
gaaggatctatcgttgatttagcgaaaaaagcgcgcgacaacaaattagcattaaaagat
ttacaaggtggaacgttcacaattacaaacggcggcgtattcggttcattaatgtctaca
ccaattttaaacgggcctcaagttggtattttaggaatgcataaagttcagcttcgtccg
gtagcaattgatgaagagcgtatcgaaaatcgtccgatgatgtacattgcactttcttac
gatcaccgtatcgttgacggcaaagaagccgtaagcttcctagctactgttaaagaacta
ttagaagatccagaatctttattactagaaggttaa

DBGET integrated database retrieval system