KEGG   Bacillus megaterium DSM 319: BMD_3248Help
Entry
BMD_3248          CDS       T01219                                 

Definition
riboflavin synthase/ferredoxin reductase FAD binding domain-containing protein (EC:1.-.-.-)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BMD_3248
  Amino acid metabolism
   00380 Tryptophan metabolism
    BMD_3248
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BMD_3248
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BMD_3248
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BMD_3248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3178653..3181802)
Genome map
AA seq 1049 aa AA seqDB search
MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIK
EACDESRFDKNLSQALKFVRDFTGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMM
VDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVR
ALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN
GKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLV
DPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQ
LHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMVLK
HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSPEQSAKKVRKKAENAHN
TPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGH
PPDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIAD
RGEADASDDFEGTYEEWREHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMH
GAFSTNVVASKELQQPGSARSTRHLEIELPKEASYQEGDHLGIIPRNYEGIVNRVTARFG
LDASQQIRLEAEEEKLAHLPLAKTVSVEELLQYVELQDPVTRTQLRAMAAKTVCPPHKVE
LEALLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSIRPRYYSISSSPRVDE
KQASITVSVVSGEAWSGYGEYKGIASNYLAELQEGDTITCFISTPQSEFTLPKDPETPLI
MVGPGTGVAPFRGFVQARKQLKEKGQSLGEAHLYFGCRSPHEDYLYQEELENAQNEGIIT
LHTAFSRVPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAG
VHQVSEADARLWLQQLEEKGRYAKDVWAG
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaagaaatgcctcagccaaaaacgtttggagagcttaaaaatttaccgtta
ttaaacacagataaaccggttcaagctttgatgaaaattgcggatgaattaggagaaatc
tttaaattcgaggcgcctggtcgtgtaacgcgctacttatcaagtcagcgtctaattaaa
gaagcatgcgatgaatcacgctttgataaaaacttaagtcaagcgcttaaatttgtacgt
gattttacaggagacgggttatttacaagctggacgcacgaaaaaaattggaaaaaagcg
cataatatcttacttccaagcttcagtcagcaggcaatgaaaggctatcatgcgatgatg
gtcgatatcgccgtgcagcttgttcaaaagtgggagcgtctaaatgcagatgagcatatt
gaagtacccgaagatatgacacgtttaacgcttgatacaattggtctttgcggctttaac
tatcgctttaacagcttttaccgagatcagcctcatccatttattacaagtatggtccgt
gcactggatgaagcaatgaacaagctgcagcgagcaaatccagacgacccagcttatgat
gaaaacaagcgccagtttcaagaagatatcaaggtgatgaacgacctagtagataaaatt
attgcagatcgcaaagcaagcggtgaacaaagcgatgatttattaacgcatatgctaaac
ggaaaagatccagaaacaggtgagccgcttgatgacgagaacattcgctatcaaattatt
acattcttaattgcgggacacgaaacaacaagcggtcttttatcatttgcgctgtatttc
ttagtgaaaaatccacatgtattacaaaaagcagcagaagaagcagcacgagttctagta
gatcctgttccaagctacaaacaagtcaaacagcttaaatatgtcggcatggtcttaaac
gaagcgctgcgcttatggccaactgctcctgcgttttccctatatgcaaaagaagatacg
gtgcttggaggagaatatcctttagaaaaaggcgacgaactaatggttctgattcctcag
cttcaccgtgataaaacaatttggggagacgatgtggaagagttccgtccagagcgtttt
gaaaatccaagtgcgattccgcagcatgcgtttaaaccgtttggaaacggtcagcgtgcg
tgtatcggtcagcagttcgctcttcatgaagcaacgctggtacttggtatggtgctaaaa
cactttgactttgaagatcatacaaactacgagctggatattaaagaaactttaacgtta
aaacctgaaggctttgtggtaaaagcaaaatcgaaaaaaattccgcttggcggtattcct
tcacctagccctgaacagtctgctaaaaaagtacgcaaaaaggcagaaaacgctcataat
acgccgctgcttgtgctatacggttcaaatatgggaacagctgaaggaacggcgcgtgat
ttagcagatattgcgatgagcaaaggattcgcaccgcaggtcgctacccttgattcacac
gccggaaatcttccgcgcgaaggagctgtattaattgtaacggcgtcttataacggacat
ccgcctgataacgcaaagcaatttgtcgactggttagaccaagcgtctgctgatgaagta
aaaggcgttcgctactccgtatttggatgcggcgataaaaactgggctactacgtatcaa
aaagtgcctgcttttatcgatgaaacgcttgccgctaaaggggcagaaaacatcgctgac
cgcggtgaagcagatgcaagcgacgactttgaaggcacatatgaagaatggcgtgaacat
atgtggagtgacgtagcagcctactttaacctcgacattgaaaacagtgaagataataaa
tctactctttcacttcaatttgtcgacagcgccgcggatatgccgcttgcgaaaatgcat
ggtgcgttttcaacgaacgtcgtagcaagcaaagaacttcaacagccaggcagtgcacga
agcacgcgacaccttgaaattgaacttccaaaagaagcttcttatcaagaaggagatcat
ttaggtattattcctcgcaactatgaaggaatagtaaaccgtgtaacagcaaggttcgga
ctagatgcatcacagcaaatccgtctggaagcagaagaagaaaaattagctcatttgcca
ctcgctaaaacagtatccgtagaagagcttctgcaatacgtggagcttcaagatcctgtt
acgcgcacgcagcttcgcgcaatggctgctaaaacggtctgcccgccgcataaagtagag
cttgaagccttgcttgaaaagcaagcctacaaagaacaagtgctggcaaaacgtttaaca
atgcttgaactgcttgaaaaatacccggcgtgtgaaatggaattcagcgaatttatcgcc
cttctgccaagcatacgcccgcgttattactcgatttcttcatcacctcgtgtcgatgaa
aaacaagcaagcatcacggtcagcgttgtctcaggagaagcgtggagcggatatggagaa
tataaaggaattgcgtcgaactatcttgctgagctgcaagaaggagatacgattacgtgc
tttatttccacaccgcagtcagaatttacgctgccaaaagaccctgaaacgccgcttatc
atggtcggaccgggaacaggcgtcgcgccgtttagaggcttcgtgcaggctcgcaagcag
ctaaaagaaaaaggacagtcgcttggagaagcgcatttatacttcggctgccgttcacct
catgaagactatctgtatcaagaagagcttgaaaacgcccaaaatgaaggcatcattacg
cttcataccgctttttctcgcgtgccaaatcagccaaaaacatacgttcagcacgtgatg
gaacaagacggcaagaaattgattgaacttcttgatcaaggagcgcacttctatatttgc
ggagacggaagccaaatggcacctgacgttgaagcaacgcttatgaaaagctatgctggc
gttcaccaagtgagtgaagcagacgctcgcttatggctgcagcagctagaggaaaaaggc
cgatacgcaaaagacgtgtgggctgggtaa

DBGET integrated database retrieval system