KEGG   Bacillus megaterium DSM 319: BMD_3248Help
Entry
BMD_3248          CDS       T01219                                 

Definition
riboflavin synthase/ferredoxin reductase FAD binding domain-containing protein (EC:1.-.-.-)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bmd00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bmd00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bmd00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3178653..3181802)
Genome map
AA seq 1049 aa AA seqDB search
MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIK
EACDESRFDKNLSQALKFVRDFTGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMM
VDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVR
ALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN
GKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLV
DPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQ
LHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMVLK
HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSPEQSAKKVRKKAENAHN
TPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGH
PPDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIAD
RGEADASDDFEGTYEEWREHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMH
GAFSTNVVASKELQQPGSARSTRHLEIELPKEASYQEGDHLGIIPRNYEGIVNRVTARFG
LDASQQIRLEAEEEKLAHLPLAKTVSVEELLQYVELQDPVTRTQLRAMAAKTVCPPHKVE
LEALLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSIRPRYYSISSSPRVDE
KQASITVSVVSGEAWSGYGEYKGIASNYLAELQEGDTITCFISTPQSEFTLPKDPETPLI
MVGPGTGVAPFRGFVQARKQLKEKGQSLGEAHLYFGCRSPHEDYLYQEELENAQNEGIIT
LHTAFSRVPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAG
VHQVSEADARLWLQQLEEKGRYAKDVWAG
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaagaaatgcctcagccaaaaacgtttggagagcttaaaaatttaccgtta
ttaaacacagataaaccggttcaagctttgatgaaaattgcggatgaattaggagaaatc
tttaaattcgaggcgcctggtcgtgtaacgcgctacttatcaagtcagcgtctaattaaa
gaagcatgcgatgaatcacgctttgataaaaacttaagtcaagcgcttaaatttgtacgt
gattttacaggagacgggttatttacaagctggacgcacgaaaaaaattggaaaaaagcg
cataatatcttacttccaagcttcagtcagcaggcaatgaaaggctatcatgcgatgatg
gtcgatatcgccgtgcagcttgttcaaaagtgggagcgtctaaatgcagatgagcatatt
gaagtacccgaagatatgacacgtttaacgcttgatacaattggtctttgcggctttaac
tatcgctttaacagcttttaccgagatcagcctcatccatttattacaagtatggtccgt
gcactggatgaagcaatgaacaagctgcagcgagcaaatccagacgacccagcttatgat
gaaaacaagcgccagtttcaagaagatatcaaggtgatgaacgacctagtagataaaatt
attgcagatcgcaaagcaagcggtgaacaaagcgatgatttattaacgcatatgctaaac
ggaaaagatccagaaacaggtgagccgcttgatgacgagaacattcgctatcaaattatt
acattcttaattgcgggacacgaaacaacaagcggtcttttatcatttgcgctgtatttc
ttagtgaaaaatccacatgtattacaaaaagcagcagaagaagcagcacgagttctagta
gatcctgttccaagctacaaacaagtcaaacagcttaaatatgtcggcatggtcttaaac
gaagcgctgcgcttatggccaactgctcctgcgttttccctatatgcaaaagaagatacg
gtgcttggaggagaatatcctttagaaaaaggcgacgaactaatggttctgattcctcag
cttcaccgtgataaaacaatttggggagacgatgtggaagagttccgtccagagcgtttt
gaaaatccaagtgcgattccgcagcatgcgtttaaaccgtttggaaacggtcagcgtgcg
tgtatcggtcagcagttcgctcttcatgaagcaacgctggtacttggtatggtgctaaaa
cactttgactttgaagatcatacaaactacgagctggatattaaagaaactttaacgtta
aaacctgaaggctttgtggtaaaagcaaaatcgaaaaaaattccgcttggcggtattcct
tcacctagccctgaacagtctgctaaaaaagtacgcaaaaaggcagaaaacgctcataat
acgccgctgcttgtgctatacggttcaaatatgggaacagctgaaggaacggcgcgtgat
ttagcagatattgcgatgagcaaaggattcgcaccgcaggtcgctacccttgattcacac
gccggaaatcttccgcgcgaaggagctgtattaattgtaacggcgtcttataacggacat
ccgcctgataacgcaaagcaatttgtcgactggttagaccaagcgtctgctgatgaagta
aaaggcgttcgctactccgtatttggatgcggcgataaaaactgggctactacgtatcaa
aaagtgcctgcttttatcgatgaaacgcttgccgctaaaggggcagaaaacatcgctgac
cgcggtgaagcagatgcaagcgacgactttgaaggcacatatgaagaatggcgtgaacat
atgtggagtgacgtagcagcctactttaacctcgacattgaaaacagtgaagataataaa
tctactctttcacttcaatttgtcgacagcgccgcggatatgccgcttgcgaaaatgcat
ggtgcgttttcaacgaacgtcgtagcaagcaaagaacttcaacagccaggcagtgcacga
agcacgcgacaccttgaaattgaacttccaaaagaagcttcttatcaagaaggagatcat
ttaggtattattcctcgcaactatgaaggaatagtaaaccgtgtaacagcaaggttcgga
ctagatgcatcacagcaaatccgtctggaagcagaagaagaaaaattagctcatttgcca
ctcgctaaaacagtatccgtagaagagcttctgcaatacgtggagcttcaagatcctgtt
acgcgcacgcagcttcgcgcaatggctgctaaaacggtctgcccgccgcataaagtagag
cttgaagccttgcttgaaaagcaagcctacaaagaacaagtgctggcaaaacgtttaaca
atgcttgaactgcttgaaaaatacccggcgtgtgaaatggaattcagcgaatttatcgcc
cttctgccaagcatacgcccgcgttattactcgatttcttcatcacctcgtgtcgatgaa
aaacaagcaagcatcacggtcagcgttgtctcaggagaagcgtggagcggatatggagaa
tataaaggaattgcgtcgaactatcttgctgagctgcaagaaggagatacgattacgtgc
tttatttccacaccgcagtcagaatttacgctgccaaaagaccctgaaacgccgcttatc
atggtcggaccgggaacaggcgtcgcgccgtttagaggcttcgtgcaggctcgcaagcag
ctaaaagaaaaaggacagtcgcttggagaagcgcatttatacttcggctgccgttcacct
catgaagactatctgtatcaagaagagcttgaaaacgcccaaaatgaaggcatcattacg
cttcataccgctttttctcgcgtgccaaatcagccaaaaacatacgttcagcacgtgatg
gaacaagacggcaagaaattgattgaacttcttgatcaaggagcgcacttctatatttgc
ggagacggaagccaaatggcacctgacgttgaagcaacgcttatgaaaagctatgctggc
gttcaccaagtgagtgaagcagacgctcgcttatggctgcagcagctagaggaaaaaggc
cgatacgcaaaagacgtgtgggctgggtaa

DBGET integrated database retrieval system