KEGG   Bacillus megaterium DSM 319: BMD_3359Help
Entry
BMD_3359          CDS       T01219                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMD_3359
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BMD_3359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3269348..3270787
Genome map
AA seq 479 aa AA seqDB search
MTKMPKNFLWGGALAAHQFEGGWNQGGKGPSVVDVMTAGAHGVARQITETVEEDKFYPNH
EAIDFYHRYKEDIALFAEMGLKCLRTSIGWSRIFPKGDEAEPNEEGLKFYDDVFDELLKH
GIEPVITLSHFEMPLHLAREYGGFRSRKTVDCFVKFAEVCFDRYKDKVTYWMTFNEINNK
MDVHNPLFLWTNSGVSVKPGENAKEVMYQAGHHELLASALAVSKGKEINPNFQIGAMVSH
VPIYPYSSNPEDVMLAEETMRQRYFFPDVQVRGYYPSYALKEFEREGYHIPFEEGDEEIL
RNGKVDYLGFSYYMSTTVKSDVEADNTGDIVNGGLPNGVANPYIKSSDWGWSIDPTGLRY
TLNRFYDRYQIPLFIVENGFGAIDTVEEDGSIHDASRIEYLKSHIEALEKAVTYDGVDLM
GYTPWGIIDIVSFTTGEMKKRYGMIYVDRDNEGSGSMKRYKKDSFNWYKHVIETNGEEL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagatgccaaagaattttttatggggcggcgcattagcagctcatcaatttgaa
ggtggatggaaccaaggcggaaaaggaccgagcgtagtagacgttatgactgcaggtgcg
cacggtgtagcgcgacaaatcactgaaacagtggaagaagataaattttatccaaatcac
gaagcaattgatttttatcaccgctataaagaagatatcgcactgtttgcagaaatgggc
ttaaaatgtttgcgaacgtctattggctggagccgtattttccctaaaggcgatgaagct
gagccaaacgaagaaggactaaaattctacgacgatgtatttgatgaactgttaaagcat
ggaattgaaccggttattacgctttctcactttgaaatgcccctgcatttagctcgagaa
tacggcggatttagaagccgaaaaacggtggactgctttgtgaagttcgctgaagtttgt
ttcgaccgctataaagacaaagtcacgtactggatgacgtttaatgaaattaacaacaaa
atggacgtacacaaccctctattcttatggacgaactccggcgtttctgtaaagccgggt
gaaaatgcaaaagaagtgatgtatcaagcaggacatcatgaactgcttgcaagcgctctt
gccgtatcaaaaggaaaagaaattaatccgaatttccaaatcggagcgatggtttcacat
gtgccaatctatccgtattcttcaaaccctgaagatgtgatgttagcagaagaaacaatg
agacagcgctacttcttccctgacgttcaagttcgcggctattacccaagctatgcgtta
aaagaattcgaacgagaaggctaccatattccgtttgaagaaggcgacgaagaaatttta
cgaaacggaaaagttgattatttaggctttagctattacatgtccacaacggttaaaagc
gacgttgaagctgataacacgggcgatatcgtaaacggcggattgccaaacggcgtagca
aatccttatatcaaatcaagcgattggggctggtcaattgatccaacgggcttgcgctat
acgttaaaccgcttctacgaccgctatcaaattccgctgttcatcgtagaaaacggattt
ggtgccattgatacggttgaagaagacggatccattcatgacgcatcacgaattgaatat
ttaaaatcgcacatcgaagcgttagaaaaagctgtaacgtacgatggtgttgatttaatg
ggctatacgccatggggaattattgatattgtttcctttacaacaggcgaaatgaaaaag
cgatacggcatgatttatgtcgaccgtgacaacgaaggaagcggatcaatgaagcgctac
aaaaaagattcctttaactggtacaaacatgtaattgaaacaaatggtgaagaactataa

DBGET integrated database retrieval system