KEGG   Bacillus megaterium DSM 319: BMD_3389Help
Entry
BMD_3389          CDS       T01219                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMD_3389
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BMD_3389
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     BMD_3389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3296728..3297621
Genome map
AA seq 297 aa AA seqDB search
MSNKYRVRKNVLHLTDTEKRDFVRTVLTLKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAH
MSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNP
KKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLNALKITQYDTP
PWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIVHHNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaagtatagagttagaaaaaacgtattacatcttaccgacacggaaaaaaga
gattttgttcgtaccgtgctaacactaaaggaaaaagggatatatgaccgctatatagcc
tggcatggtgcagcaggtaaatttcatactcctccgggaagcgatcgaaatgcagcacat
atgagttctgcttttttaccgtggcatcgtgaataccttttacgattcgaacgtgacctt
cagtcaatcaatccagaagtaacccttccttattgggaatgggaaacggacgcacagatg
caggatccctcacaatcacaaatttggagtgcagattttatggggggaaacggaaatccc
aaaaaagattttatcgtcgataccgggccatttgcagctgggcgctggacgacgatcgat
gaacaaggaaatccttccggagggctaaaacgtaattttggagcaacgaaagaggcacct
acactccctactcgagatgatgttctcaatgctttaaaaataactcagtatgatacgccg
ccttgggatatgaccagccaaaacagctttcgcaatcagcttgaaggatttattaacggg
ccacagcttcacaatcgcgtacaccgttgggttggcggacagatgggcgttgtgcctact
gctccgaatgatccggtcttctttttacaccacgcaaatgtggatcgtatttgggctgta
tggcaaattgttcatcataatcaaaactatcagccgatgaaaaacgggccatttggtcaa
aactttagagatccgatgtacccttggaatacaacccctgaagacgttatgaaccatcga
aagcttgggtacgtatacgatatagaattaagaaaatcaaaacgttcctcataa

DBGET integrated database retrieval system