KEGG   Bacillus megaterium DSM 319: BMD_3389Help
Entry
BMD_3389          CDS       T01219                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bmd00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:bmd00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3296728..3297621
Genome map
AA seq 297 aa AA seqDB search
MSNKYRVRKNVLHLTDTEKRDFVRTVLTLKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAH
MSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNP
KKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLNALKITQYDTP
PWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIVHHNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaagtatagagttagaaaaaacgtattacatcttaccgacacggaaaaaaga
gattttgttcgtaccgtgctaacactaaaggaaaaagggatatatgaccgctatatagcc
tggcatggtgcagcaggtaaatttcatactcctccgggaagcgatcgaaatgcagcacat
atgagttctgcttttttaccgtggcatcgtgaataccttttacgattcgaacgtgacctt
cagtcaatcaatccagaagtaacccttccttattgggaatgggaaacggacgcacagatg
caggatccctcacaatcacaaatttggagtgcagattttatggggggaaacggaaatccc
aaaaaagattttatcgtcgataccgggccatttgcagctgggcgctggacgacgatcgat
gaacaaggaaatccttccggagggctaaaacgtaattttggagcaacgaaagaggcacct
acactccctactcgagatgatgttctcaatgctttaaaaataactcagtatgatacgccg
ccttgggatatgaccagccaaaacagctttcgcaatcagcttgaaggatttattaacggg
ccacagcttcacaatcgcgtacaccgttgggttggcggacagatgggcgttgtgcctact
gctccgaatgatccggtcttctttttacaccacgcaaatgtggatcgtatttgggctgta
tggcaaattgttcatcataatcaaaactatcagccgatgaaaaacgggccatttggtcaa
aactttagagatccgatgtacccttggaatacaacccctgaagacgttatgaaccatcga
aagcttgggtacgtatacgatatagaattaagaaaatcaaaacgttcctcataa

DBGET integrated database retrieval system