KEGG   Bacillus megaterium DSM 319: BMD_3406Help
Entry
BMD_3406          CDS       T01219                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00260  Glycine, serine and threonine metabolism
bmd00750  Vitamin B6 metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01230  Biosynthesis of amino acids
Module
bmd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMD_3406 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMD_3406 (thrC)
Enzymes [BR:bmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMD_3406 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Cys_rich_KTR
Motif
Other DBs
NCBI-ProteinID: ADF40246
UniProt: D5DHC5
Position
complement(3313019..3314236)
Genome map
AA seq 405 aa AA seqDB search
MMPFSYVSHLYCPKCKNEYSPKEKHQLCKCGSPLLVAYDLERLKDNLSPEDVQSREPNLW
RYHELLPVEDPENVVSLGEGMTPLIKMPKLGKEMDIPNLYMKDEGIIPTGSFKARGAAVG
VSKAKELGVEQLAMPTNGNAGAAWSLYSSRADIKATVVMPKDAPVITRNECAVAGADLYL
VDGLISDAGKIVGEAIKAWGLYDASTLKEPYRIEGKKTMGLEIAEQFSWNLPDVILYPTG
GGVGLIGIYKALNELKELGWIKGDLPRLVAVQAENCAPIVKAWNERKQESEFWPDSSTIA
FGINVPKAIGDFLVLEAVYNTNGCAIAVDEDKIVEEQKKVAQLEGSFICPEGAATFLAAR
RLREEGWIKDNETVVALNTGLGVKYPNTVDIEVPVLERNGSLTKK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtttagttatgtttctcacttatattgtcctaaatgtaaaaatgaatatagt
ccaaaagaaaaacatcaattatgtaaatgtggctcacctttattagtagcgtatgattta
gagagactgaaagacaatctaagtccagaagatgtccaaagcagagaaccgaatctatgg
agatatcatgaactgcttccagtagaagatccagaaaacgtcgtttccttaggagaaggg
atgactccgcttataaaaatgcctaagctaggtaaagaaatggacattccaaacttatat
atgaaagatgaaggtattattccaacgggatcatttaaagctagaggcgctgctgtaggg
gtgtcaaaagcaaaagaacttggcgttgaacagttagcgatgcctacaaatggcaacgct
ggagctgcttggtcgctttattcgtcacgcgctgacataaaagcaaccgtcgtgatgcca
aaagatgcgcctgttattacacgaaatgagtgtgctgtcgctggagctgacctttactta
gtagatggactcatcagcgatgcgggtaaaattgtcggtgaggctattaaagcctggggt
ctttatgacgcttctacgcttaaagaaccgtaccgaatagaaggtaaaaaaacaatgggc
ctggaaattgctgaacagttttcttggaatcttcctgatgtgattttatatccaacagga
ggaggcgttggattaatcggaatctacaaagcgttaaatgaattaaaagagcttggctgg
attaaaggtgatcttcctcgtttagttgcggtacaagctgaaaactgcgcgcctattgta
aaagcgtggaatgaaagaaaacaagaatctgaattttggccggattcttcaaccattgcc
tttggtatcaacgtaccaaaagcaatcggggactttcttgttttagaggccgtatacaat
acaaatggatgcgcgattgcggtggatgaagataaaattgtggaggaacaaaaaaaggtt
gcgcagcttgaaggttcgttcatttgtcctgaaggtgctgccacatttttagctgcacgc
cgtttgcgagaagaaggctggattaaagataacgaaacggttgtggctttaaatacaggg
cttggagttaaatatccaaacacggtagatattgaagtacctgttttagagcgaaatggc
agccttactaaaaaataa

DBGET integrated database retrieval system