KEGG   Bacillus megaterium DSM 319: BMD_3573Help
Entry
BMD_3573          CDS       T01219                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BMD_3573 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMD_3573 (mhpF)
   00650 Butanoate metabolism
    BMD_3573 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BMD_3573 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMD_3573 (mhpF)
   00622 Xylene degradation
    BMD_3573 (mhpF)
   00621 Dioxin degradation
    BMD_3573 (mhpF)
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BMD_3573 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3456720..3457637)
Genome map
AA seq 305 aa AA seqDB search
MRKVKAAIIGSGNIGTDLMYKLQRSEFIELTAVLGIDPDSDGLKRAREAGYQTYSNGIKA
LAENPDLAEIIFDATSAKAHVRHAKILKDLGKMVIDLTPAAKGPFVCPPVNLGENLESEN
VNMITCGGQATIPIIYAINQVADVTYGEIVATISSLSAGPGTRANIDEFTVTTRKAIEKV
GGADCGKAIILLNPADPPILMRDTIYCKVKNMNKEAIQKAIKDMVKKVQEYVPGYNLKQE
PLFDSDQVTVFLEVTGAGDYFPSYAGNLDIMTAAAAKVAEDYARYKLEESLYGGIKKERA
MTNET
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaagtaaaagccgcaattattggctcaggaaatattgggacagatttgatgtat
aagcttcagcgcagtgaatttatcgagttaacagctgtacttggaattgatccggattca
gatggtctaaaaagagcgagagaagcaggatatcaaacatacagcaatggtataaaagcc
cttgctgaaaatccagatctggcggaaattatttttgatgctacatcggctaaggctcac
gttagacatgcaaagattttaaaagacttaggaaaaatggttatcgacttaactcctgct
gccaaaggacctttcgtgtgtcctcccgttaatcttggagaaaatcttgaatcagaaaat
gtaaacatgattacgtgcggcggacaagcgacgattcctatcatctatgcaatcaaccaa
gttgcagatgtaacatatggagaaattgtagctactatttctagcctaagcgctggacca
ggaacacgagcaaatattgatgagtttactgttaccacaaggaaagctattgaaaaagta
ggcggtgccgactgcggaaaagctattattctcttaaatccggctgatccacctatctta
atgcgcgatacaatttattgtaaagtgaaaaatatgaataaggaagctattcaaaaggct
atcaaagatatggtcaaaaaagtacaagaatatgtaccgggctataatttaaagcaagaa
ccattatttgatagtgatcaagtaacagtctttttagaggtaactggagccggagattat
tttccttcttatgccggtaacttagatattatgacggctgctgcagcgaaggttgcggaa
gattatgcccgctacaaactcgaagagagcttatatggaggaataaagaaagagagggct
atgacgaatgaaacgtaa

DBGET integrated database retrieval system