KEGG   Bacillus megaterium DSM 319: BMD_4077Help
Entry
BMD_4077          CDS       T01219                                 

Gene name
lexA
Definition
LexA repressor (EC:3.4.21.88)
Orthology
K01356  
repressor LexA [EC:3.4.21.88]
Organism
bmd  Bacillus megaterium DSM 319
Brite
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     BMD_4077 (lexA)
Peptidases [BR:bmd01002]
 Serine Peptidases
  Family S24: LexA family
   BMD_4077 (lexA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3926586..3927203
Genome map
AA seq 205 aa AA seqDB search
MKLSKRQQDILDFIKHEVKLKGYPPSVREIGEAVGLASSSTVHGHLARLESKGLIRRDPT
KPRAIEVLQLDEVNIPKSNVINVPVIGKVTAGLPITAVENVEEYFPLPDKFVSPDDHVFM
LEIMGESMIEAGILDGDMVIVRQQQTANNGDIVVAMTEDNEATVKRFFKEENFVRLQPEN
STMAPIILRHVTILGKVTGVYRTIH
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagctatcaaaacgtcaacaagacatactagattttattaagcatgaagtaaaatta
aaaggttatccgccttctgttcgtgagattggggaagcggtaggattagcctctagctcc
actgtacacgggcatttagctcgtttagaaagcaaagggttaattcgcagagatccgaca
aaaccaagagcaatcgaagttcttcaactagacgaagtaaacatccctaaaagcaatgtc
attaatgttcctgttatcggtaaagtaacagcgggtctgcctataacagccgttgaaaat
gtggaagaatatttccctcttccagataaattcgtttctccagatgatcatgtatttatg
cttgaaattatgggggaaagtatgattgaagcaggtattctagatggcgatatggtaatc
gtacgtcagcagcaaacagctaataatggagatattgtggtcgctatgaccgaagacaac
gaagcaacggtaaaacgtttctttaaagaagaaaatttcgttcgtttacagcctgaaaat
tcaacgatggcgcctattattcttcgccacgtaacgattttaggaaaagtaactggtgta
tatcgcacgattcactaa

DBGET integrated database retrieval system