KEGG   Bacillus megaterium DSM 319: BMD_4146Help
Entry
BMD_4146          CDS       T01219                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bmd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4007756..4008904)
Genome map
AA seq 382 aa AA seqDB search
MKKISLLGATGSIGTQTVDIVRAHPEHFELSAISVGRNINEARKIIQQCKPALVSVMKKE
DCLSLQAEFPSIRFVYGEEGLVEVATHPSTEVLVNAVLGSVGLTPTLEAIKMRKTIAIAN
KETLVTAGHLVMEAAKEYGADILPVDSEHSAIFQSLQGQDQKAIDRLILTASGGSFRDKT
RAELQGVTVEDALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFSLPYEKIDVLLHKES
IIHSMVEYSDTSVIAQLGTPDMRVPIQYALTYPKRMSLPNTKRLSLADIGQLHFAKMDEE
RFRCLAFAFEAGKAGGTLPTVLNAANEEAVQAFLDGHITFLQIEDVIEKAMNEHTVIQKP
CLSTIKEVDLEAREFVRSAISR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaatttccttgttaggagctacaggttcaatcggtactcaaaccgttgatatt
gttcgagcgcatccggagcattttgagctctcagcaatctctgtaggtcgaaatattaat
gaagcaagaaagattattcagcagtgtaagccagcccttgtttctgtgatgaagaaagaa
gattgtctgtcactgcaagcagaattcccttctattcgatttgtttatggagaagaaggg
cttgtggaagtggcaactcatccatccacagaagttttagtaaatgctgttcttggaagt
gtagggttgactcctacgctagaagcaatcaaaatgagaaaaacgattgctattgcaaat
aaggagacacttgttaccgctggtcaccttgtcatggaagcagccaaggaatatggcgct
gatattttaccggtagacagtgagcactcagctatttttcaaagtttgcaagggcaagat
caaaaagcaatagaccgtttaattttaacagcttctggaggaagctttcgagataaaacg
agagcagaactacagggagtaacggttgaagatgcattaaatcatccaaactggtcgatg
ggagctaaaattacaattgattcggcaacgatgatgaataaggggttagaagtgattgaa
gcacattggctttttagtcttccctatgagaaaattgatgtattgttacataaggaaagc
atcattcattctatggtagagtattcggatacaagcgttattgcccagcttggaacgcct
gatatgcgcgtgccaattcaatacgcgttaacgtatccaaaacgcatgtctttgcctaac
accaagcgtttaagtttggcggatattggtcagcttcacttcgctaaaatggatgaagag
cgttttcgctgtttagcttttgcatttgaggctggcaaagcgggtggaacacttccgact
gttttaaacgcagctaatgaagaagctgttcaagcctttttagatggtcacattacattt
ttacaaattgaagatgtgattgaaaaagcaatgaatgaacatactgtaatacagaaacct
tgtttatctactattaaagaagtagatttagaagcaagagagtttgttagatccgccatc
tctcgataa

DBGET integrated database retrieval system