KEGG   Bacillus megaterium DSM 319: BMD_4306Help
Entry
BMD_4306          CDS       T01219                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMD_4306 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMD_4306 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMD_4306 (trpB)
Enzymes [BR:bmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMD_4306 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4165950..4167164)
Genome map
AA seq 404 aa AA seqDB search
MTYNHPDEFGRFGEFGGKYVPETLMKPLEEVEAALNQAMKDPAFKDEYLSLLVNYSGRPT
ALTYADNITETLGGAKIYLKREDLNHTGAHKINNAIGQILLAKRMGKTKIIAETGAGQHG
VATATVAAKFGMECKVFMGEEDIERQALNVFRMKLLGAEVIPATSGTKTLKDATNEAIRY
WVQHCEDHFYLIGSAIGPHPYPKMVRDFQKIIGEEAKEQFTAVEGKLPNAVVACVGGGSN
AIGMFYDFIKEENVRLIGVEAGGKGLNTALHAAKMAKGTKGVIHGTLTYLLQDENGQITE
PYSISAGLDYPGIGPEHSHLSSIGRVEYESVTDDESIEALQLLAKTEGIIPAIESAHALA
KAFELAKSMTKEETILICLSGRGDKDVHTLVNLLEGKEEEHEYV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaatcatcctgatgaatttggccgctttggtgaatttggcggaaaatacgta
cctgaaacattaatgaagccacttgaagaagtagaagcagctttgaatcaagcaatgaaa
gatccggcatttaaagatgagtatctatccttacttgttaactactctgggcgaccaaca
gctttaacatatgctgataatattaccgaaacgctcggcggggcaaaaatttatttgaaa
cgtgaagacttaaatcatacgggtgctcacaaaatcaataatgccattggacagatttta
cttgctaaacgtatgggaaaaacaaaaattattgctgaaacaggagcgggtcagcacggg
gtagccacagctacagtagctgcaaagttcggaatggaatgtaaagtattcatgggagaa
gaagatattgaacgtcaggcgttgaacgtctttcgcatgaagcttctaggagcggaagtc
attcctgcaacttctgggacaaaaacgctaaaagatgcaacaaatgaagcaattcgctac
tgggttcaacattgcgaagatcatttttacttaattggttcggccattggaccacaccct
tatcctaaaatggttcgagatttccaaaaaattattggagaagaagcaaaagaacagttt
acagcggtagaaggcaaacttccgaatgctgtcgtggcatgcgtcggaggcggcagtaat
gcaatcggaatgttttatgattttattaaagaagaaaatgtacgcttgatcggcgtagaa
gcaggagggaaaggactaaatacagccctccatgctgctaaaatggctaaaggcacaaaa
ggtgttattcacggaacgctcacgtatttacttcaagatgaaaatggtcagattacagag
ccttattctatttcagcaggtttggattatccaggtatcggtccagagcattctcacctt
tcatctattggacgagtagaatatgaaagtgtaacggatgatgagtcaatcgaagctctt
cagctgcttgcgaaaacagagggaatcatcccggctattgagtccgcccatgcgctggca
aaagcatttgaactggctaaaagcatgacgaaagaagaaaccattttaatttgcttgtca
ggtcgaggagataaggacgttcatacattagtaaacttgctagaagggaaggaagaagaa
catgaatacgtttga

DBGET integrated database retrieval system