KEGG   Bacillus megaterium DSM 319: BMD_4308Help
Entry
BMD_4308          CDS       T01219                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmd01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bmd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4167777..4168544)
Genome map
AA seq 255 aa AA seqDB search
MLNKIIETKKEEIQNLQLPEQQNVAKRSFLDALSNPNRELALIAEVKKASPSKGLIKENF
QPVEIAKAYEKGKADALSVLTDQHYFQGNRTFLSDIKQHVSIPVLRKDFIIDSIQVEESA
RIGADAILLIGEALEPLKLQELYLQAAEKELDCLVEVHSLETLEKLLAVFTPKIIGINNR
NLHTFETSVQQTKEIAKHVPKNQLLVSESGIYLYDDVSYVKEAGAKAILVGESLMRQDNQ
TKAIEKLFGESEYAH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgctcaataaaattattgaaacaaaaaaagaagaaattcaaaacttacagttacccgaa
cagcaaaatgttgcaaaacgatcattcttagacgctttatcaaatccgaatcgagagctg
gctcttattgcagaagtgaaaaaagcttctccttccaaaggattaataaaagagaatttt
cagcctgtggaaattgctaaagcctacgagaaagggaaagcagatgctttgtctgtgtta
acagatcagcactattttcaaggaaaccgaacgtttttaagtgacattaaacagcatgtc
tctatccctgtgcttcgcaaggatttcatcattgattccattcaagtggaagaaagtgca
agaatcggtgctgatgctattttactcattggagaagcacttgaaccattaaaattgcaa
gagctttatcttcaagctgctgaaaaagagttagattgtttagtagaagtgcattctcta
gaaacgcttgaaaagctgctagctgtatttaccccgaagattattggcattaataatcga
aatcttcacacgtttgaaaccagcgtgcagcagaccaaagaaatcgccaagcatgttccg
aaaaatcagctgctagtgagtgaaagcggaatttacttatacgatgatgtttcctacgta
aaagaagcgggagcaaaagctattttagtaggggaatcgcttatgaggcaggataatcaa
accaaagcgattgaaaagctgtttggggaaagtgaatatgctcattaa

DBGET integrated database retrieval system