KEGG   Bacillus megaterium DSM 319: BMD_4422Help
Entry
BMD_4422          CDS       T01219                                 

Gene name
mutA
Definition
methylmalonyl-CoA mutase subunit beta (EC:5.4.99.2)
Orthology
K01847  
methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMD_4422 (mutA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMD_4422 (mutA)
   00640 Propanoate metabolism
    BMD_4422 (mutA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMD_4422 (mutA)
Enzymes [BR:bmd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     BMD_4422 (mutA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4273728..4275764)
Genome map
AA seq 678 aa AA seqDB search
MKTNTLSFHEFTRTPKEDWAQEVSKNTAISSKETLENIFLKPLYFESDTAHLDYLQQSPA
GIDCLRGAGKESYILGEWEITQKIDLPSIKESNKLLLHSLRNGQNTAAFTCSEAMRQGKD
VDEATEAEVASGTTISTLEDVAHLFQHVALEAVPLFLNTGCTSVPLLSFLKAYCVDHNFN
MRQLKGTVGMDPLGTLAEYGRVPLSTRDLYDHLAYATRLAHSNVPELKTIIVSSIPYHNS
GANAVQELAYMLATGVQYIDECIKRGLSLHQVLPHMTFSFSVSSHLFMEISKLRAFRMLW
ANVVRAFDDTAVSVPFIHTETSHLTQSKEDMYTNALRSTVQAFASIVGGADSLHIEPYDS
VTSSSSQFAHRLARNTHLILQHETHISKVMDPAGGSWYVEAYTHELMTKAWELFGNIEDH
GGMEEALKQGRIQDEVEQMKVKRQEDIECRIERLIGVTHYAPKQQDVSQEIKSTPFKKEE
IKMGKYSDQNASEFSSNLSLEDYTKLASKGVTAGGMLKQMAKQTQPDSVVPLTKWRAAEK
FEKIRVYTKGMSIGIMELTDPSSRKKTEIARSLFESAGFACETIKNIDSYVEIADWMNEQ
KHEAYVICGSDELVEKLLTKAMTYFEEDSVYVYVVGEEHVSRKTQWQQKGVMSVIHPKTN
VIQCVKKLLCALEVEVHV
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaatacattatcatttcatgaatttacacgtacacctaaagaagattgggca
caggaagttagcaaaaataccgcgatctcttcaaaagaaacgttggaaaacatctttttg
aaaccgctttatttcgaaagtgatacggcacatttagactacttacagcagagtccggcg
ggaatagattgtttaagaggagccggtaaagaatcatacatactaggggaatgggaaatc
acccaaaaaatcgacttaccttctattaaagaaagcaataaacttcttttacacagtttg
agaaatggacaaaatacggccgcttttacgtgcagtgaagcaatgaggcaagggaaagac
gttgatgaagcaactgaagctgaagtagcctcaggcactacaatttctactttagaggat
gttgctcatttgtttcagcatgtagctcttgaagcggtgcctttatttttaaatacggga
tgtacatccgttccgcttctttcgtttctaaaagcatactgtgttgatcataactttaat
atgagacagctaaaaggaacggttggaatggatccgctcggcacccttgctgaatatgga
agagttccactttctactcgagatttatacgatcatttagcttacgcaacgcgtttggct
cacagtaatgttccagagctcaaaacgatcattgtatcaagcattccttaccataacagc
ggtgcaaacgctgttcaagaactagcttatatgcttgctacaggggtgcagtatattgat
gaatgcataaaacgcggtttgtccttacatcaagttttacctcatatgaccttttctttt
tcagttagctcacatttatttatggaaatatcaaaacttcgtgcttttcgcatgctttgg
gcaaatgtggttcgtgcttttgatgacacggccgtttcagtgccgtttatccatacagaa
acgtcacatcttacacagtctaaagaagacatgtatacaaatgcattaaggagcacggtt
caagcatttgcttctattgtaggaggagcggatagtctgcatattgaaccatatgattcc
gtcacatcttcatcttctcagttcgctcatcgccttgcccgtaacactcacttaattttg
cagcacgaaacacatatatcaaaagtaatggatcctgccggaggctcttggtacgttgaa
gcctacacacatgaattaatgacaaaagcttgggagttatttggcaacattgaagaccac
ggcggaatggaagaagctttaaaacaagggcgaattcaagatgaagttgaacaaatgaaa
gtaaaaagacaagaggatatagagtgccgaattgagcgcttgatcggagtcacacactat
gctcctaagcaacaggatgtatctcaagagataaaaagcacgccgtttaaaaaagaagaa
ataaaaatgggtaaatacagtgaccagaacgcttcggaattttcatcaaatctttcacta
gaggactatacaaagctagcatctaaaggggtaacagcagggggaatgctaaaacaaatg
gcgaagcagacacagcctgacagtgttgtgccgctcactaagtggagagcagcagagaag
tttgaaaaaatacgggtttatacaaaggggatgagcattggcattatggagctcaccgat
cctagcagccgtaaaaaaactgagattgcccggtctttatttgaaagcgcaggttttgcg
tgtgaaacaattaaaaacatagattcctatgtcgagatagcagattggatgaatgaacaa
aagcacgaagcatatgtgatctgtggaagtgatgaactcgtggaaaagctcttaacaaaa
gcgatgacttattttgaggaagattccgtttatgtgtacgtagtaggggaagaacatgta
tcacgcaaaacgcagtggcagcaaaaaggtgtaatgagcgtcatacatcctaagacgaat
gttattcaatgcgttaagaagttattatgtgctttggaggtagaagttcatgtataa

DBGET integrated database retrieval system