KEGG   Bacillus megaterium DSM 319: BMD_4422Help
Entry
BMD_4422          CDS       T01219                                 

Gene name
mutA
Definition
methylmalonyl-CoA mutase subunit beta (EC:5.4.99.2)
Orthology
K01847  
methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bmd01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bmd00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bmd00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bmd00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4273728..4275764)
Genome map
AA seq 678 aa AA seqDB search
MKTNTLSFHEFTRTPKEDWAQEVSKNTAISSKETLENIFLKPLYFESDTAHLDYLQQSPA
GIDCLRGAGKESYILGEWEITQKIDLPSIKESNKLLLHSLRNGQNTAAFTCSEAMRQGKD
VDEATEAEVASGTTISTLEDVAHLFQHVALEAVPLFLNTGCTSVPLLSFLKAYCVDHNFN
MRQLKGTVGMDPLGTLAEYGRVPLSTRDLYDHLAYATRLAHSNVPELKTIIVSSIPYHNS
GANAVQELAYMLATGVQYIDECIKRGLSLHQVLPHMTFSFSVSSHLFMEISKLRAFRMLW
ANVVRAFDDTAVSVPFIHTETSHLTQSKEDMYTNALRSTVQAFASIVGGADSLHIEPYDS
VTSSSSQFAHRLARNTHLILQHETHISKVMDPAGGSWYVEAYTHELMTKAWELFGNIEDH
GGMEEALKQGRIQDEVEQMKVKRQEDIECRIERLIGVTHYAPKQQDVSQEIKSTPFKKEE
IKMGKYSDQNASEFSSNLSLEDYTKLASKGVTAGGMLKQMAKQTQPDSVVPLTKWRAAEK
FEKIRVYTKGMSIGIMELTDPSSRKKTEIARSLFESAGFACETIKNIDSYVEIADWMNEQ
KHEAYVICGSDELVEKLLTKAMTYFEEDSVYVYVVGEEHVSRKTQWQQKGVMSVIHPKTN
VIQCVKKLLCALEVEVHV
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaatacattatcatttcatgaatttacacgtacacctaaagaagattgggca
caggaagttagcaaaaataccgcgatctcttcaaaagaaacgttggaaaacatctttttg
aaaccgctttatttcgaaagtgatacggcacatttagactacttacagcagagtccggcg
ggaatagattgtttaagaggagccggtaaagaatcatacatactaggggaatgggaaatc
acccaaaaaatcgacttaccttctattaaagaaagcaataaacttcttttacacagtttg
agaaatggacaaaatacggccgcttttacgtgcagtgaagcaatgaggcaagggaaagac
gttgatgaagcaactgaagctgaagtagcctcaggcactacaatttctactttagaggat
gttgctcatttgtttcagcatgtagctcttgaagcggtgcctttatttttaaatacggga
tgtacatccgttccgcttctttcgtttctaaaagcatactgtgttgatcataactttaat
atgagacagctaaaaggaacggttggaatggatccgctcggcacccttgctgaatatgga
agagttccactttctactcgagatttatacgatcatttagcttacgcaacgcgtttggct
cacagtaatgttccagagctcaaaacgatcattgtatcaagcattccttaccataacagc
ggtgcaaacgctgttcaagaactagcttatatgcttgctacaggggtgcagtatattgat
gaatgcataaaacgcggtttgtccttacatcaagttttacctcatatgaccttttctttt
tcagttagctcacatttatttatggaaatatcaaaacttcgtgcttttcgcatgctttgg
gcaaatgtggttcgtgcttttgatgacacggccgtttcagtgccgtttatccatacagaa
acgtcacatcttacacagtctaaagaagacatgtatacaaatgcattaaggagcacggtt
caagcatttgcttctattgtaggaggagcggatagtctgcatattgaaccatatgattcc
gtcacatcttcatcttctcagttcgctcatcgccttgcccgtaacactcacttaattttg
cagcacgaaacacatatatcaaaagtaatggatcctgccggaggctcttggtacgttgaa
gcctacacacatgaattaatgacaaaagcttgggagttatttggcaacattgaagaccac
ggcggaatggaagaagctttaaaacaagggcgaattcaagatgaagttgaacaaatgaaa
gtaaaaagacaagaggatatagagtgccgaattgagcgcttgatcggagtcacacactat
gctcctaagcaacaggatgtatctcaagagataaaaagcacgccgtttaaaaaagaagaa
ataaaaatgggtaaatacagtgaccagaacgcttcggaattttcatcaaatctttcacta
gaggactatacaaagctagcatctaaaggggtaacagcagggggaatgctaaaacaaatg
gcgaagcagacacagcctgacagtgttgtgccgctcactaagtggagagcagcagagaag
tttgaaaaaatacgggtttatacaaaggggatgagcattggcattatggagctcaccgat
cctagcagccgtaaaaaaactgagattgcccggtctttatttgaaagcgcaggttttgcg
tgtgaaacaattaaaaacatagattcctatgtcgagatagcagattggatgaatgaacaa
aagcacgaagcatatgtgatctgtggaagtgatgaactcgtggaaaagctcttaacaaaa
gcgatgacttattttgaggaagattccgtttatgtgtacgtagtaggggaagaacatgta
tcacgcaaaacgcagtggcagcaaaaaggtgtaatgagcgtcatacatcctaagacgaat
gttattcaatgcgttaagaagttattatgtgctttggaggtagaagttcatgtataa

DBGET integrated database retrieval system