KEGG   Bacillus megaterium DSM 319: BMD_4487Help
Entry
BMD_4487          CDS       T01219                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00010  Glycolysis / Gluconeogenesis
bmd00052  Galactose metabolism
bmd00500  Starch and sucrose metabolism
bmd00520  Amino sugar and nucleotide sugar metabolism
bmd00521  Streptomycin biosynthesis
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01130  Biosynthesis of antibiotics
bmd01200  Carbon metabolism
Module
bmd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMD_4487 (glk)
   00052 Galactose metabolism
    BMD_4487 (glk)
   00500 Starch and sucrose metabolism
    BMD_4487 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BMD_4487 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMD_4487 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BMD_4487 (glk)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMD_4487 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADF41316
UniProt: D5DMI4
Position
complement(4334512..4335480)
Genome map
AA seq 322 aa AA seqDB search
MDDKWLVGVDLGGTTIKMAFINHYGEIIHKWEINTDVSEQGRKIPTDIAKAIDKKLNDLG
EVKSRLVGIGIGAPGPVNFANGSIEVAVNLGWEKFPIKDILEVETSLPVVVDNDANIAAI
GEMWKGAGDGAKDLLCVTLGTGVGGGVIANGEIVQGVNGAAGEIGHITSIPEGGAPCNCG
KTGCLETIASATGIVRLTMEELTETDKPSELRTVLEQNGQVTSKDVFDAARSKDGLAMHV
VDKVAFHLGLALANSANALNPEKIVLGGGVSRAGEVLLAPVRDYFKRFAFPRVAQGAELA
IATLGNDAGIIGGAWLVKSYFE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaatggttagttggagttgatttaggcggtacaacaataaaaatggccttt
attaatcattatggagaaatcattcacaagtgggaaattaatacggatgtgagcgagcaa
ggccgtaaaattccaacggatattgcaaaagcaattgataaaaagttaaacgatcttgga
gaagtaaaatcaaggttagtaggaattggcattggtgcaccggggcctgtcaactttgca
aacggttcgattgaagtagctgtcaatttaggttgggaaaaattccctataaaagatatc
ttggaagtagaaacttctcttcctgttgtagtagacaatgatgcaaacattgcagcgatt
ggagaaatgtggaagggtgctggagacggagcaaaagatttactttgcgttacgcttggc
acaggcgttggcggtggcgtcattgcaaacggtgaaattgtacaaggcgtaaatggagcc
gctggtgagatcgggcacattacttctattcctgaaggcggggcaccgtgtaactgcggt
aaaaccggctgtttagaaaccattgcttcagcaactggaattgtacgtttaacaatggaa
gaattaacggaaacggacaaaccaagtgagcttcgcacagtgttagaacaaaatggacaa
gttacatctaaagatgtatttgatgcagctcgttcaaaagacgggttagctatgcatgtt
gtagataaagttgcttttcatttaggtctagcactagcaaactctgctaatgcattaaac
cctgagaagatcgttctaggcggcggtgtgtctcgtgcaggcgaggtattacttgcaccg
gtaagagattatttcaaacgttttgcatttcctcgcgtagcgcaaggtgctgaactagca
atcgctactttaggaaacgatgcgggaattattggaggagcttggttagttaaatcttat
tttgaataa

DBGET integrated database retrieval system