KEGG   Bacillus megaterium DSM 319: BMD_4487Help
Entry
BMD_4487          CDS       T01219                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMD_4487 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMD_4487 (glk)
   00052 Galactose metabolism
    BMD_4487 (glk)
   00500 Starch and sucrose metabolism
    BMD_4487 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BMD_4487 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMD_4487 (glk)
   00524 Butirosin and neomycin biosynthesis
    BMD_4487 (glk)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMD_4487 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4334512..4335480)
Genome map
AA seq 322 aa AA seqDB search
MDDKWLVGVDLGGTTIKMAFINHYGEIIHKWEINTDVSEQGRKIPTDIAKAIDKKLNDLG
EVKSRLVGIGIGAPGPVNFANGSIEVAVNLGWEKFPIKDILEVETSLPVVVDNDANIAAI
GEMWKGAGDGAKDLLCVTLGTGVGGGVIANGEIVQGVNGAAGEIGHITSIPEGGAPCNCG
KTGCLETIASATGIVRLTMEELTETDKPSELRTVLEQNGQVTSKDVFDAARSKDGLAMHV
VDKVAFHLGLALANSANALNPEKIVLGGGVSRAGEVLLAPVRDYFKRFAFPRVAQGAELA
IATLGNDAGIIGGAWLVKSYFE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaatggttagttggagttgatttaggcggtacaacaataaaaatggccttt
attaatcattatggagaaatcattcacaagtgggaaattaatacggatgtgagcgagcaa
ggccgtaaaattccaacggatattgcaaaagcaattgataaaaagttaaacgatcttgga
gaagtaaaatcaaggttagtaggaattggcattggtgcaccggggcctgtcaactttgca
aacggttcgattgaagtagctgtcaatttaggttgggaaaaattccctataaaagatatc
ttggaagtagaaacttctcttcctgttgtagtagacaatgatgcaaacattgcagcgatt
ggagaaatgtggaagggtgctggagacggagcaaaagatttactttgcgttacgcttggc
acaggcgttggcggtggcgtcattgcaaacggtgaaattgtacaaggcgtaaatggagcc
gctggtgagatcgggcacattacttctattcctgaaggcggggcaccgtgtaactgcggt
aaaaccggctgtttagaaaccattgcttcagcaactggaattgtacgtttaacaatggaa
gaattaacggaaacggacaaaccaagtgagcttcgcacagtgttagaacaaaatggacaa
gttacatctaaagatgtatttgatgcagctcgttcaaaagacgggttagctatgcatgtt
gtagataaagttgcttttcatttaggtctagcactagcaaactctgctaatgcattaaac
cctgagaagatcgttctaggcggcggtgtgtctcgtgcaggcgaggtattacttgcaccg
gtaagagattatttcaaacgttttgcatttcctcgcgtagcgcaaggtgctgaactagca
atcgctactttaggaaacgatgcgggaattattggaggagcttggttagttaaatcttat
tttgaataa

DBGET integrated database retrieval system