KEGG   Bacillus megaterium DSM 319: BMD_4602Help
Entry
BMD_4602          CDS       T01219                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bmd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4434541..4436898)
Genome map
AA seq 785 aa AA seqDB search
MNEEQVNPSQPERHYISGTSIVTVFHNEENLYNVTRIRIKKTNLEIEDKETVVTGYFPKL
NEDEVYTFYGDFKEHPKFGLQFHVEQFKKELPQSRQGVVQYLSSDLFHGIGKKTAENIVD
ALGERAIFRILQNESVLKEVPRLSADKAEALVTQLREHQGLEEVMVKLTDLGFGPQLSMK
IFQAYKQEALEIVQNNPYQLVEDIQGIGFSRADELGKRLGMATNHPDRLRAGILYVIEQE
CNQMGHVYVTADQLYGKTAELLRKSRHENLSEMDLTREVDALKADKKLIIQDEKIYFPPL
FYAEKGLVKAIQKIMAQTQYEEQFPESEFLLALGELEERLDVQYAPSQRKGIQTALMSPM
LLLTGGPGTGKTTVIKGIVELYAELHGCSLNPGDYKKDEAFPVLLVAPTGRAAKRMSEAT
GLPAVTIHRLLKWNGQEGFDHNEENPIDGKLLIVDEVSMVDLWLAHQLFKSLPANLQVIL
VGDEDQLPSVGPGQVLKDLLSSEVVPTVRLTDVYRQAEGSSIIDLAHEIKKGKLPEDLSR
QQGDRSFIRCQGQHITNVVQQVCGNALKKGYTAKDIQVLAPMYKGPAGIDKLNEVLQELF
NPASEQRRELKHGDITYRVGDKVLQLVNQPDSNVFNGDMGEIVSVFFAKENTEKQDMLVI
SYEGNEVTYTKQDFNQITHAYCCSIHKSQGSEFPIVVLPIVKSYYRMLRRNLLYTAVTRS
KQFLILCGEDEAFQLGVSRNEDSVRQTNLQPLLRESLDNDIEDPEIPFMKDANIGMENVT
PYDFM
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagaacaagtgaacccttcacagccagaacgtcattatataagcggcacgtcg
attgtaaccgtctttcataacgaagaaaacttatataacgttacgcggatacggatcaaa
aaaacaaatttagagattgaagataaagaaacggtcgtcacaggttattttcctaagctg
aatgaagatgaagtatacacgttttacggagacttcaaagagcatccaaagtttggtctg
cagtttcatgttgaacagtttaaaaaagaacttccgcaatcaaggcaaggggttgttcag
tacctatctagcgatttatttcacggaatcggtaaaaaaaccgctgaaaacattgtggac
gctctaggagaacgcgctatttttcgtattttgcaaaatgagtctgtgctaaaagaggtt
ccgaggctttcagccgacaaggcagaagctttagtcacgcagcttcgtgaacatcaaggg
ttagaagaagtaatggtaaagctgacagaccttgggtttggaccgcagctttcgatgaag
attttccaagcgtacaaacaagaagcgcttgaaattgttcaaaataatccttatcagctc
gtagaagatattcaaggtattggctttagcagagccgatgaacttggaaagaggcttggt
atggcaaccaatcatcctgatcgtttgcgtgcaggtattttatatgtcattgagcaagaa
tgcaatcaaatggggcatgtatacgtcacggcagatcagctgtatggaaaaacagcagag
cttcttcggaaaagcaggcatgagaatctgtctgaaatggatcttacaagagaagtggac
gcattaaaagcagataaaaagcttatcattcaagacgaaaaaatttattttcctcccctt
ttctatgctgaaaaagggctggttaaagctattcaaaaaattatggctcaaacgcagtac
gaagagcagtttccggaatcagaattcttattggctctgggtgaactagaagagcggtta
gacgtgcaatatgcaccgtctcagcgcaagggtatacaaaccgctttaatgtctccaatg
cttcttttaacaggtggaccaggtacagggaaaacaacggttattaaaggaatagtcgaa
ctttatgcagaacttcacggatgttcgttaaatccaggggactataaaaaagatgaagct
tttcctgttttacttgtggcacccacgggacgagctgctaaacgaatgagcgaagcgacg
ggacttccggcagttacgattcaccgattattaaaatggaacggacaagaaggatttgat
cataatgaggagaatccaattgacggaaagttattgattgtggatgaagtatcaatggta
gatttgtggcttgctcatcagctgtttaaatctcttcctgctaatttacaggttatttta
gttggagacgaagatcagcttccgtcagtaggtccgggccaggtgttaaaagatttgctg
agttcagaagtagttcctaccgtccgtctgacagatgtatacaggcaagcggaagggtcg
tcaattattgatttggctcatgaaataaaaaaaggaaagcttccggaagacttatcaagg
cagcaaggagatcgttcctttattcgttgtcaaggacagcacattacgaacgtcgtgcaa
caagtttgcgggaatgcgttaaaaaaaggctatacggctaaagatattcaagttttagct
cctatgtataaaggtcctgcaggtattgataagctgaatgaagttcttcaggaattattc
aacccggcttctgagcaacgaagagagcttaagcacggagatattacgtaccgagtcgga
gataaagtgctgcagcttgtaaatcagccggatagcaacgtatttaacggagatatggga
gaaatcgtctcggttttctttgccaaagaaaatacggaaaaacaggatatgctggttatt
tcatatgaaggaaatgaagtaacttacacaaagcaagactttaatcaaataactcatgca
tactgctgttccattcataaatcacagggaagtgaatttcccattgttgtgcttccaatt
gttaaaagctattaccggatgctgcgacgcaatttactttataccgccgttacgcgaagc
aaacagtttttaattttatgcggtgaagacgaagcgtttcagcttggagtcagccgaaat
gaagacagcgttcgccaaacgaatttacagcccttgcttcgagaaagcttggataatgac
atagaagatcccgaaattccatttatgaaagatgcaaatattgggatggaaaacgttacg
ccgtatgatttcatgtaa

DBGET integrated database retrieval system