KEGG   Bacillus megaterium DSM 319: BMD_4630Help
Entry
BMD_4630          CDS       T01219                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMD_4630 (ruvA)
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BMD_4630 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4466450..4467061)
Genome map
AA seq 203 aa AA seqDB search
MFDYIKGTVTYINPEYVVIENNGIGYQVFTPNPYVFSIDEQPKTVYTYQYVREDVIALYG
FASREQKDLFMKLISVSGIGPKGGLAILASGNPAQVVQAVEEEDEKFLVKFPGVGKKTAR
QMILDLKGKLHDIVPDAVPSLFADLDAQEVKSQSSEALDEAIEALKVLGYAEREIKKIVP
ALMKETMTTDQYIKEALKRLLKQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgattatatcaaaggtactgttacatatataaatcctgagtatgtagtaatcgaa
aacaacgggataggctatcaagtctttacgccgaatccatatgtattttcaattgatgaa
caacccaagacggtttacacctatcaatatgtaagagaagacgtaattgcactttacggg
tttgcttcccgagaacaaaaggatttatttatgaagttaattagcgtgtcaggaattggc
ccaaaaggcggtttagctattttggcgtcaggtaatccagcgcaggttgtccaagctgtg
gaagaggaagacgagaagtttttagttaagtttccaggagtaggtaaaaaaacagctcga
cagatgattctagatttaaaaggaaagctgcatgatattgtaccagatgccgttccttct
ttattcgcagatttggacgcacaagaagtcaaatctcaaagttcagaagcactggatgaa
gcgattgaagcacttaaagtattaggttatgcagaaagagaaatcaaaaaaattgttccg
gctttaatgaaggaaacgatgacaacggatcagtatattaaagaagcgttaaagcgatta
ttgaaacaataa

DBGET integrated database retrieval system