KEGG   Bacillus megaterium DSM 319: BMD_4669Help
Entry
BMD_4669          CDS       T01219                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00860  Porphyrin and chlorophyll metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMD_4669 (hemD)
Enzymes [BR:bmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BMD_4669 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF2748 DNA_photolyase
Motif
Other DBs
NCBI-ProteinID: ADF41493
UniProt: D5DLL7
Position
complement(4504032..4504805)
Genome map
AA seq 257 aa AA seqDB search
MSHEAPLFLKTVLITREAKQAHSFAAQIKKLGGIPLSLPVLTFARSNNEKEVEDVLLSID
CFDWIVFTSQNGISFFFEWLKELNISWSALKRLKVAAVGEKTAKLLEKHDVNVQLVPKEY
VAESLLESLKANVAHHERVLLVRGQLARSVLKDGLKECEVTDLVVYQTIRNQDSERLVKQ
HLETGIDAITFTSSSIVRFFVESVKDIPNWLELINRAKVVCIGPITSQTASEYGIKHLVP
NTYTINGMIDMLVSCFE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgaggctcctctttttttaaaaacagttttgattacaagagaagcgaagcag
gctcattcatttgcagcacagattaaaaagcttggaggtatacctttaagcttaccagtc
ctcacgttcgcacgttctaacaatgaaaaagaagtggaagatgtcctgctgtcgattgac
tgttttgattggattgtttttacaagtcaaaacggcatttcttttttctttgaatggcta
aaagagttaaatatcagttggagtgctttaaaaagattaaaagtggctgcggttggagaa
aaaaccgcaaaattgctagaaaaacatgatgttaacgtgcaacttgttccaaaagaatac
gtggcggaatcacttcttgagtcgttaaaagcaaatgtggcacatcacgagcgagttctc
cttgtacgaggacaattagcccgctctgttttaaaagatgggttaaaagagtgtgaggta
acggatttagttgtatatcagaccattcgaaatcaagattctgaacgcttggttaagcaa
catttagaaacaggaattgatgccattacttttacaagttcttctatagtgaggtttttt
gtcgagtcagttaaagacattccgaattggcttgagcttataaatagagccaaagttgtt
tgcatcggtcctattacgagtcagacagcgagcgaatatggaattaagcatcttgttcct
aacacatacacaataaatggtatgatagatatgttggttagttgttttgaataa

DBGET integrated database retrieval system