KEGG   Bacillus megaterium DSM 319: BMD_4689Help
Entry
BMD_4689          CDS       T01219                                 

Gene name
rdgB
Definition
non-canonical purine NTP pyrophosphatase (EC:3.6.1.-)
Orthology
K02428  
dITP/XTP pyrophosphatase [EC:3.6.1.19]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bmd00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bmd00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4527524..4528117)
Genome map
AA seq 197 aa AA seqDB search
MREIIIATKNAGKVKDFETLFSPKGFKVKSLLDFPEIEDVEETGVTFAENATLKAEAISS
ALNKPVIADDSGLAIDALNGEPGVYSARYAGENKDDNANIEKVLQKLNDVPFEKRTARFH
CALAIAVPGKRTEIVEGTCEGHILEEKRGENGFGYDPIFFVEKWRCSMAELTKEQKNQIS
HRANALKRLAPLIDAQF
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgaaatcattattgcaactaaaaacgcaggcaaagtaaaagattttgaaacactt
ttctcaccgaagggatttaaagtaaaatcgcttcttgattttcctgagattgaagacgtg
gaagaaacgggcgttacatttgcagagaatgccacgctaaaagcagaggccatttcatcc
gcattaaataagccggtcattgccgatgattcggggcttgctattgatgccttaaacggg
gagccaggcgtttattccgcgcgttatgctggtgaaaataaagatgataatgctaatata
gagaaggtacttcaaaaattaaatgacgtgccgtttgaaaagcgcacggcacgctttcat
tgtgctcttgctattgcagtgcccggaaagagaaccgaaattgtagaaggcacgtgtgaa
gggcacatcttggaggaaaaaagaggggaaaacggttttgggtacgatcccattttcttt
gtagaaaaatggagatgctccatggcagaattgaccaaagagcaaaaaaatcagattagt
caccgagcaaatgcgttaaaaagactagcaccgctaattgatgcgcaattttag

DBGET integrated database retrieval system