KEGG   Bacillus megaterium DSM 319: BMD_4689Help
Entry
BMD_4689          CDS       T01219                                 

Gene name
rdgB
Definition
non-canonical purine NTP pyrophosphatase (EC:3.6.1.-)
Orthology
K02428  
XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BMD_4689 (rdgB)
Enzymes [BR:bmd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BMD_4689 (rdgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4527524..4528117)
Genome map
AA seq 197 aa AA seqDB search
MREIIIATKNAGKVKDFETLFSPKGFKVKSLLDFPEIEDVEETGVTFAENATLKAEAISS
ALNKPVIADDSGLAIDALNGEPGVYSARYAGENKDDNANIEKVLQKLNDVPFEKRTARFH
CALAIAVPGKRTEIVEGTCEGHILEEKRGENGFGYDPIFFVEKWRCSMAELTKEQKNQIS
HRANALKRLAPLIDAQF
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgaaatcattattgcaactaaaaacgcaggcaaagtaaaagattttgaaacactt
ttctcaccgaagggatttaaagtaaaatcgcttcttgattttcctgagattgaagacgtg
gaagaaacgggcgttacatttgcagagaatgccacgctaaaagcagaggccatttcatcc
gcattaaataagccggtcattgccgatgattcggggcttgctattgatgccttaaacggg
gagccaggcgtttattccgcgcgttatgctggtgaaaataaagatgataatgctaatata
gagaaggtacttcaaaaattaaatgacgtgccgtttgaaaagcgcacggcacgctttcat
tgtgctcttgctattgcagtgcccggaaagagaaccgaaattgtagaaggcacgtgtgaa
gggcacatcttggaggaaaaaagaggggaaaacggttttgggtacgatcccattttcttt
gtagaaaaatggagatgctccatggcagaattgaccaaagagcaaaaaaatcagattagt
caccgagcaaatgcgttaaaaagactagcaccgctaattgatgcgcaattttag

DBGET integrated database retrieval system