KEGG   Bacillus megaterium DSM 319: BMD_4804Help
Entry
BMD_4804          CDS       T01219                                 

Gene name
ccpA
Definition
(GenBank) catabolite control protein A
  KO
K02529  
LacI family transcriptional regulator
Organism
bmd  Bacillus megaterium DSM 319
Brite
Transcription factors [BR:bmd03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    BMD_4804 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4644061..4645059)
Genome map
AA seq 332 aa AA seqDB search
MNVTIYDVAREASVSMATVSRVVNGNPNVKPSTRKKVLETIERLGYRPNAVARGLASKKT
TTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGI
IFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNI
AFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKP
TAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAV
AMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtaacaatttatgatgtagcaagggaagcaagcgtgtcgatggcaacggtttct
cgtgtggtaaacggaaatccaaatgtaaaaccatcaactagaaaaaaagtattagaaaca
attgaaagactaggctatcgtccgaacgcagtagcgcgtggattagcaagtaaaaaaaca
acgacagtaggagttatcattcctgatatttcaaatattttctatgcagagttagcgcgt
ggaatcgaagatattgcaacaatgtacaaatataatatcatcttaagtaactccgatcaa
aatcaagataaagaacttcaccttttaaataacatgcttggtaaacaagtagacggaatc
atcttcatgagtgggaatgtaacggaagaacacgtagaagagctaaaaaaatcaccggtt
ccagttgtccttgcagcatcaatcgaatcaactaaccaaatcccatctgtaactattgat
tatgaacaagcagcttttgatgcagtgcaatcactaattgacagcggtcataaaaatatt
gcattcgtttcaggtacgttagaagaaccgatcaatcatgcgaaaaaagtaaaagggtac
aagcgtgctcttacggaaagcggattgcctgtacgtgattcttatattgtagaaggagac
tacacgtacgattcaggtattgaagcggttgaaaaactattagaagaagatgaaaaacca
actgctattttcgttggaacggatgaaatggcattaggcgttattcacggggcacaagac
cgcgggttgaatgtaccaaacgatctagaaattatcggttttgataacacaagactttca
acaatggttcgtcctcagttaacatctgttgtacagccaatgtatgatattggtgcagta
gcgatgcgtctcttaacaaaatacatgaacaaagaaacggtagacagcagcattgtacag
cttcctcaccgcatcgagttcagacaatcaacaaaataa

DBGET integrated database retrieval system