KEGG   Bacillus megaterium DSM 319: BMD_4885Help
Entry
BMD_4885          CDS       T01219                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMD_4885 (glgB)
Enzymes [BR:bmd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BMD_4885 (glgB)
Exosome [BR:bmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMD_4885 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4725649..4727610)
Genome map
AA seq 653 aa AA seqDB search
MFEVKGVAKVNLAVQPTEFDVHLYHEGNLFRSYSIFGAHQVTVEGIEGVRFCVWAPHAKS
VSVVGDFNKWNGSQHSMVKVNEEGIWMTFIPELEQGTIYKYEIITQSNQKKLKADPYAFF
SEVRPNTASIVYSLAGYKWNDQYWRRKKKQQNIYERPLCIYELHAGSWRTHEDGSLYTYS
ELAQELIPYIAEQGFTHIELLPVIEHPLDRSWGYQGTGYYSATSRYGTPKELMNFIDECH
QNNIGVLLDWVPGHFCKDEHGLYMFDGEPTYEYKKESDRENYVWGTANFDLGKPEVQSFL
ISNALFWLEYFHIDGFRVDAVANMLYWQNSSGKAVNDGAVSFLKKLNEAVFESDETVLMM
AEDSTDWPLVTAPTYEGGLGFNYKWNMGWMNDVLTYMEAGVERRPYLHDKMTFSLMYAFN
ENFILPLSHDEVVHGKKSLLNKMPGDYWRKFAQLRLLYGYFFAHPGKKLLFMGGEFGQFD
EWKDLEELDWMLYDFDMHRNLNGYMKDLIKIYKRSKPLYELDHNPDGFEWIDVNNHHQQI
FSFIRKSKENQEIFIVVSNFSEHPYHSYKVGVPVETEYIEVINSDDEVYGGSGIVNKKAL
KSVDESFHGQPFCIEMNIPPFGISILRAKRKRGERKQHVKKEMRSDVIGRRKR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagttaaaggggtggcaaaagtgaatctagcggttcagcctactgaatttgat
gttcatttgtatcacgaaggaaacttatttcgcagttactctattttcggtgcgcatcag
gtaacggtagaaggaattgaaggcgtacgattttgcgtgtgggcacctcatgcaaagagt
gtaagcgttgtaggtgattttaataaatggaacggttctcaacattcaatggttaaagtt
aatgaagaaggtatttggatgacatttatccctgaattagaacaagggactatttataaa
tatgaaatcatcacacaaagcaatcaaaaaaaattaaaagcagatccatacgctttcttc
agcgaagtgcgtccaaacactgcgtctattgtttactcattggctgggtacaaatggaac
gatcaatactggcgtagaaagaaaaaacagcaaaatatatatgaaagaccgctgtgtatt
tacgagctgcatgcagggtcttggaggactcatgaagatggcagcctttatacatacagt
gaattagcacaggagcttattccttatattgctgaacaaggttttacacatatcgagtta
ttaccagtcattgagcatccgctcgaccgatcctgggggtatcaaggaactggatactat
tcggctaccagtcgatacggtacacccaaagagttgatgaactttatagatgagtgtcat
caaaacaatataggggttcttttagattgggtacccgggcatttttgtaaggatgaacat
ggtctgtatatgttcgatggagaacctacttatgaatacaaaaaagagtccgatcgtgaa
aactacgtttggggaacagctaatttcgatttaggaaagcctgaagtacaaagttttcta
atttccaatgctttgttttggttggagtacttccatatagatggatttcgagtagatgct
gtagctaatatgctttattggcaaaattcttctggaaaagcagtgaatgatggagctgtc
agcttcttgaaaaagttgaatgaagctgtttttgaatctgatgaaacggtattaatgatg
gcagaagattcaacggactggccgcttgttacagcacctacgtatgagggcggtttaggc
tttaattataaatggaatatgggatggatgaatgacgttttaacatacatggaagctggc
gtggaaagacgtccctatcttcacgataaaatgaccttttcactaatgtatgcgtttaac
gaaaattttattttgccgctttcccatgatgaagtcgtacatgggaaaaaatcattactt
aataagatgccaggtgattactggcgcaagtttgcacagcttcgactgctatatggatac
ttctttgcacacccgggaaaaaagcttttatttatgggcggagagtttggccaatttgat
gagtggaaagatttagaggagttggattggatgctttatgactttgatatgcatcgcaat
cttaatggatatatgaaggatctcatcaagatttataaaagaagcaagcctttatatgaa
ttagaccataatccagatggattcgaatggattgatgttaacaaccatcatcaacaaatc
ttctcttttattcgtaagtcgaaagaaaatcaggagatttttatagttgttagcaatttt
tctgagcatccatatcattcttacaaagttggagttccagttgagacagagtacattgaa
gttattaacagtgatgacgaagtgtacggcggttcaggcattgtaaataaaaaggcatta
aaatcagtggatgaatcgtttcacggtcaacctttttgcattgaaatgaatattccgccg
tttggcattagtatactacgagcaaagagaaaacgaggggagagaaaacaacatgttaaa
aaagaaatgcgtagcgatgttattggcaggaggaaaaggtag

DBGET integrated database retrieval system