KEGG   Bacillus megaterium DSM 319: BMD_4961Help
Entry
BMD_4961          CDS       T01219                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMD_4961 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMD_4961 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMD_4961 (thrC)
Enzymes [BR:bmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMD_4961 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4779024..4780088)
Genome map
AA seq 354 aa AA seqDB search
MMWKGLLAEYKEFLPVTEKTPMLTLHEGNTPLIHLAQLSKELGIDLHVKVEGLNPTGSFK
DRGMVMAVAKAKEEGSNTVICASTGNTSAAAAAYASRAGMRCIVVIPNGKIAMGKLAQAV
MYGAEIVAIEGNFDQALSMVRKLSETSPVALVNSVNPYRIEGQKTASFEICEQLGKAPDV
LAIPVGNAGNITAYWKGFKEYSERHQTSLPHMHGFEAEGAAAIVRNQVIENPETIATAIR
IGNPASWDYAVNAAKESNGKIDEVTDEQILEAYRTIARKEGVFAEPGSCASIAGVFKDVA
SGKIAKGSTVVAVLTGNGLKDPNVAIDAHNVKPVVLPNDEEKVFEYIQGVVASC
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggaaaggtctattagctgaatataaagaatttttacctgtaacagagaaaaca
cctatgcttacattacatgaaggaaatacgcctttaattcatcttgctcagttatcaaaa
gagctaggcattgatctacatgtgaaagtagaagggttaaatccaacggggtcatttaaa
gaccgcggaatggtaatggctgtagcaaaagcaaaagaagaaggaagcaatacggttatt
tgtgcatctacaggtaacacatccgcagctgcagcagcttatgcatcacgcgctggcatg
cgctgtatcgttgttattccaaatggaaaaattgcgatggggaaattagctcaagctgtt
atgtatggtgcagaaattgtagcaattgaaggaaactttgaccaagcactttctatggtt
cgtaagctgagtgaaacatcaccggttgcacttgtaaactctgtaaacccataccgtatt
gaagggcaaaaaacagcttctttcgagatttgtgaacagcttggaaaagcgcctgacgtt
ttagctattccagtggggaatgcaggaaacattacagcttactggaaaggcttcaaagaa
tacagtgagcgtcaccaaacgtctcttcctcacatgcacgggtttgaagcagaaggtgca
gcggcgatcgtgcgtaatcaagttatcgaaaatccagaaacaattgcaacggctattcga
atcggaaatccagcaagctgggattatgctgtaaacgcagcaaaagaatcaaacggaaaa
attgatgaagtaacagatgaacaaatcttagaagcatatcgtacaattgcacgcaaagaa
ggtgtatttgcagagccaggttcttgcgcttcaatagctggtgtgtttaaagatgtagct
tctggtaaaattgcaaaaggttcaacggttgtagctgtactaacaggtaacggattaaaa
gatccaaacgtagcaatcgatgctcataatgtaaaaccagtggttttaccaaatgatgaa
gaaaaggtatttgagtatatccaaggtgtcgttgcttcatgctag

DBGET integrated database retrieval system