KEGG   Bacillus megaterium DSM 319: BMD_5036Help
Entry
BMD_5036          CDS       T01219                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMD_5036 (tpiA)
   01230 Biosynthesis of amino acids
    BMD_5036 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMD_5036 (tpiA)
   00051 Fructose and mannose metabolism
    BMD_5036 (tpiA)
   00562 Inositol phosphate metabolism
    BMD_5036 (tpiA)
Enzymes [BR:bmd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMD_5036 (tpiA)
Exosome [BR:bmd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMD_5036 (tpiA)
  Exosomal proteins of bladder cancer cells
   BMD_5036 (tpiA)
  Exosomal proteins of melanoma cells
   BMD_5036 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4850594..4851349)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKVLSEATSFVEEVKGAVPSPESVDSVVCAPALFLDRLVEATKGTDLK
IGAQNMHFEENGAFTGEVSPVALADLGVNYVILGHSERREMFAETDETVNQKTIAAFKHG
LTPIVCCGETNEEYEQDQTKTVVANQVQKALAGLTDEQVKQTVIAYEPIWAIGTGKSSTA
EGANEVCAYIRSVVAEQFSQDVADAVRIQYGGSVKPANIKEYMSQSDIDGALVGGASLEA
DSFLQLLEAGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggaaactggaaaatgaacaaagtactttctgaagcaact
agctttgttgaagaagtaaaaggagcagtaccatctcctgaaagcgtagattcagtagta
tgtgcacctgcactatttttagatcgtttagtagaagcgactaaaggcacagacttaaaa
attggtgcacaaaacatgcactttgaagaaaacggtgcgttcactggagaagtgagccct
gttgctttagcagacttaggtgtgaactatgtcattttaggacactctgagcgtcgtgaa
atgtttgctgaaacggacgaaacagtaaaccaaaaaacaattgctgcattcaaacacggt
ttaacaccaatcgtttgctgcggtgaaacaaacgaagagtacgaacaagatcaaacaaaa
acagttgtagctaatcaagtacaaaaagcattagctggtctaactgatgagcaagtaaag
caaacagttattgcatatgagccaatttgggcaatcggtacaggtaaatcttcaactgct
gaaggtgcaaacgaagtttgtgcatacatccgtagtgttgttgcagaacaattctctcaa
gatgttgcagatgctgtacgtattcaatacggcggtagcgtaaaacctgctaatattaaa
gaatatatgtctcaatcagacattgacggagctttagtaggtggagcaagcttagaagca
gattctttcttacagcttttggaggctggtaagtaa

DBGET integrated database retrieval system