KEGG   Bacillus megaterium DSM 319: BMD_5117Help
Entry
BMD_5117          CDS       T01219                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00040  Pentose and glucuronate interconversions
bmd00052  Galactose metabolism
bmd00500  Starch and sucrose metabolism
bmd00520  Amino sugar and nucleotide sugar metabolism
bmd01100  Metabolic pathways
bmd01130  Biosynthesis of antibiotics
Module
bmd_M00362  Nucleotide sugar biosynthesis, prokaryotes
bmd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMD_5117 (galU)
   00052 Galactose metabolism
    BMD_5117 (galU)
   00500 Starch and sucrose metabolism
    BMD_5117 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BMD_5117 (galU)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMD_5117 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADF41916
UniProt: D5DNI9
Position
complement(4932105..4932989)
Genome map
AA seq 294 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEDILIVSGRGK
RAIEDHFDKSYELEETLAAKEKWDMLEEVQGISNLANVHYIRQKEPKGLGHAIHCARSFI
GDEPFAVMLGDDVVQSETPCLKQLMDVYEKYECAVVGVQEVPRKETSKYGIVGPKGEPLE
KGLLDVETLVEKPNPEEAPSGYAIMGRYILTPEIFDILSREEIGAGGEIQLTDAILRLNE
FQRVLAYYFEGKRYDVGDKFGFIKATIDLALQREPLREELVSYFREIVGKEGHM
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattcgtaaagctattattcctgcagctggattagggacacgctttttgccggct
acaaaagcacagcctaaagaaatgctgccaattgtagataaaccaacgattcaatacatt
gtggaagaagcagtagcatcaggtattgaagatattttaattgtaagcggtcgcggaaaa
cgagcaatcgaagaccattttgataaatcatatgagttagaagaaacattagccgcaaag
gaaaagtgggacatgctcgaagaagtgcaggggatttcgaatttggctaatgttcactac
attcgtcaaaaggaacctaaagggttaggtcatgccattcactgtgcaagaagttttatc
ggagatgaaccttttgctgttatgctaggcgatgatgtagttcaatcagaaacaccttgt
ttgaaacagttaatggatgtatacgaaaaatatgaatgcgctgtagttggtgtacaggag
gtgcctaggaaagaaacttcaaagtacggaattgtaggtcctaaaggagagcctcttgaa
aaaggattattagacgtagaaacgctcgttgaaaaaccgaatccagaagaggccccttct
ggctatgcaattatggggcgctatattttaacaccggaaatttttgatatcttaagcaga
gaagagattggcgcaggaggagaaattcaattaacagatgctattttacgcctgaatgaa
tttcaacgtgttcttgcttattatttcgaaggaaaacgttatgatgttggagataaattt
ggattcattaaagcaacaattgatttagctctgcaaagagaaccgctgcgagaagagtta
gtgagctattttagagaaattgtcggaaaagaagggcatatgtaa

DBGET integrated database retrieval system