KEGG   Bacillus megaterium DSM 319: BMD_5148Help
Entry
BMD_5148          CDS       T01219                                 

Gene name
rpiB
Definition
(GenBank) ribose 5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00030  Pentose phosphate pathway
bmd00051  Fructose and mannose metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
bmd01120  Microbial metabolism in diverse environments
bmd01130  Biosynthesis of antibiotics
bmd01200  Carbon metabolism
bmd01230  Biosynthesis of amino acids
Module
bmd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bmd_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMD_5148 (rpiB)
   00051 Fructose and mannose metabolism
    BMD_5148 (rpiB)
Enzymes [BR:bmd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BMD_5148 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: ADF41947
UniProt: D5DM63
Position
complement(4963818..4964279)
Genome map
AA seq 153 aa AA seqDB search
MKVAIASDHGGINLRQEIISLMEELNIEYVDLGCECTASVDYPDYALPVAQKVASQEVSR
GILICGTGIGMSIAANKVKGIRCALVHDTFSAKATREHNDSNILAMGERVIGPGLAREIA
KIWLMTEFEGGRHENRVNKIKQYEQQSDATLTV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagctattgcatctgaccacggcggtataaatttgcgacaggaaattatctct
ttaatggaagaattaaatattgaatatgtggatttagggtgtgaatgcacagcgtccgta
gactatccggattatgcacttcccgttgctcaaaaagtggcgagccaagaagtaagtcga
ggcattcttatttgtggaacaggcatcggtatgagtatagcagctaataaagtaaaagga
attcgctgtgctctagtgcatgatacgtttagtgcaaaagcgacaagagaacataatgat
agcaacattttggcaatgggtgaacgtgtcattgggccgggacttgcacgtgaaattgcg
aaaatttggttaatgacagaatttgaaggcggccgacatgaaaatcgcgtgaataaaatt
aaacagtatgagcagcaaagtgatgcaacattaactgtataa

DBGET integrated database retrieval system