KEGG   Bacillus megaterium DSM 319: BMD_5148Help
Entry
BMD_5148          CDS       T01219                                 

Gene name
rpiB
Definition
ribose 5-phosphate isomerase B (EC:5.3.1.6)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMD_5148 (rpiB)
   01230 Biosynthesis of amino acids
    BMD_5148 (rpiB)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMD_5148 (rpiB)
   00051 Fructose and mannose metabolism
    BMD_5148 (rpiB)
Enzymes [BR:bmd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BMD_5148 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4963818..4964279)
Genome map
AA seq 153 aa AA seqDB search
MKVAIASDHGGINLRQEIISLMEELNIEYVDLGCECTASVDYPDYALPVAQKVASQEVSR
GILICGTGIGMSIAANKVKGIRCALVHDTFSAKATREHNDSNILAMGERVIGPGLAREIA
KIWLMTEFEGGRHENRVNKIKQYEQQSDATLTV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagctattgcatctgaccacggcggtataaatttgcgacaggaaattatctct
ttaatggaagaattaaatattgaatatgtggatttagggtgtgaatgcacagcgtccgta
gactatccggattatgcacttcccgttgctcaaaaagtggcgagccaagaagtaagtcga
ggcattcttatttgtggaacaggcatcggtatgagtatagcagctaataaagtaaaagga
attcgctgtgctctagtgcatgatacgtttagtgcaaaagcgacaagagaacataatgat
agcaacattttggcaatgggtgaacgtgtcattgggccgggacttgcacgtgaaattgcg
aaaatttggttaatgacagaatttgaaggcggccgacatgaaaatcgcgtgaataaaatt
aaacagtatgagcagcaaagtgatgcaacattaactgtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system