KEGG   Bacillus megaterium DSM 319: BMD_5171Help
Entry
BMD_5171          CDS       T01219                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMD_5171 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BMD_5171 (mmgA)
   00640 Propanoate metabolism
    BMD_5171 (mmgA)
   00650 Butanoate metabolism
    BMD_5171 (mmgA)
  Lipid metabolism
   00071 Fatty acid degradation
    BMD_5171 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BMD_5171 (mmgA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMD_5171 (mmgA)
   00310 Lysine degradation
    BMD_5171 (mmgA)
   00380 Tryptophan metabolism
    BMD_5171 (mmgA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMD_5171 (mmgA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMD_5171 (mmgA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMD_5171 (mmgA)
Enzymes [BR:bmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMD_5171 (mmgA)
Exosome [BR:bmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMD_5171 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4987881..4989044)
Genome map
AA seq 387 aa AA seqDB search
MGKTVIVSAVRTPFGKLGGSVSGLKAAELGGKAIQAASKGRTEIDSVIMGCVLQGGQGQL
PSRQAMHYAGLPWQVETETINKVCASGMRSITTADQLIRLGEAKTIIAGGMESMSNAPYL
LPKARWGFRMGDSIVTDLMIHDGLTCSFTGVQMGTYGNEIAAEMDISREKQDEWALRSHQ
LAVESEEKGRWTAERISVDIPSKKGTITVQKDEGPRKDTSLEKLSSLRPVFGHSGTITAG
NAPSVNDGAAALMLMDEEVAKANGYEPLATIVNHTSLAMEPREFPKTPGFAINKLLQKTN
KTVDDIALFEINEAFSAVALMSMEIAGLPAEKVNVNGGAVALGHPIGASGARIVVTLIHE
LRRRGGGLGIASICSGGGQGDAIMVEV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtggggaaaacagttattgtgagtgcagttcgaacaccttttggaaaattaggtggcagc
gtaagtggactaaaagcggcagagctaggcgggaaagcgattcaagcagcgtcaaaggga
cgtacagaaattgattccgttattatgggatgcgtgctgcaagggggccaaggacagctg
ccttctaggcaagccatgcattatgcaggtttaccgtggcaagtagagacggaaaccatt
aataaagtttgtgcatcaggcatgcgcagtattacaactgctgatcagctgattcgatta
ggagaagcaaaaacaatcattgcaggtggaatggaatccatgagtaatgcaccgtacctt
cttccaaaagcaagatgggggttccgtatgggagatagcattgtgacagatttgatgatt
catgacggtttgacatgcagctttacaggggttcaaatgggtacatatggaaatgaaata
gctgctgaaatggatatttcccgagaaaagcaggatgaatgggcccttcgcagtcatcaa
ttagcagtagagtcagaagagaaagggagatggaccgcagaaagaatttcagttgatatt
ccgtctaaaaaaggaacgataacggttcaaaaagatgaaggaccaagaaaagacacgtcg
ttagaaaaactttcttctcttcggcctgtatttggccacagcggaaccattacagcagga
aatgcacctagcgtgaatgacggagcagctgcgctcatgctaatggatgaagaagtggca
aaagcaaatggctatgagccgttggctacgattgtaaaccatacttctcttgcgatggag
ccaagggaatttccgaaaacgcctgggtttgctattaacaagctattgcaaaaaacaaat
aagacagtagacgatattgcgctgtttgaaatcaatgaagctttttcagcagtagcgttg
atgagtatggaaattgcagggcttccggctgaaaaagtaaatgtcaacggcggggctgta
gcacttggacatccgattggagcaagcggcgcccgtattgttgtaacgctcattcatgaa
ttaagacgacgaggcggcggactaggcattgcttctatttgcagcggcggcggccaaggt
gatgccatcatggtagaagtataa

DBGET integrated database retrieval system