KEGG   Brucella melitensis bv. 1 16M: BMEI0160Help
Entry
BMEI0160          CDS       T00072                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMEI0160
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMEI0160
   00650 Butanoate metabolism
    BMEI0160
  Energy metabolism
   00190 Oxidative phosphorylation
    BMEI0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:154751..155137
Genome map
AA seq 128 aa AA seqDB search
MNNDMRTSLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA
LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA
ILKLSFGG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgatatgcgtacttcgctcgggaaggttcgcggtctgggttcggcaaaagaa
ggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccgctggttctg
tttttcatcggcctggtcatttcgctcaatggcgcaagctatgcggaagtccgggctgcc
ctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcacgggcgtttatcac
atgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggcatgaagatc
gtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgcgttttcgcg
atcctcaagctcagctttggaggttga

DBGET integrated database retrieval system