KEGG   Brucella melitensis bv. 1 16M: BMEI0160Help
Entry
BMEI0160          CDS       T00072                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00020  Citrate cycle (TCA cycle)
bme00190  Oxidative phosphorylation
bme00650  Butanoate metabolism
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01200  Carbon metabolism
Module
bme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bme_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMEI0160
   00650 Butanoate metabolism
    BMEI0160
  Energy metabolism
   00190 Oxidative phosphorylation
    BMEI0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ribophorin_II
Motif
Other DBs
NCBI-ProteinID: AAL51342
UniProt: Q8YJC6
Position
I:154751..155137
Genome map
AA seq 128 aa AA seqDB search
MNNDMRTSLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEVRAA
LSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLACVFA
ILKLSFGG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgatatgcgtacttcgctcgggaaggttcgcggtctgggttcggcaaaagaa
ggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccgctggttctg
tttttcatcggcctggtcatttcgctcaatggcgcaagctatgcggaagtccgggctgcc
ctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcacgggcgtttatcac
atgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggcatgaagatc
gtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgcgttttcgcg
atcctcaagctcagctttggaggttga

DBGET integrated database retrieval system