KEGG   Brucella melitensis bv. 1 16M: BMEI0238Help
Entry
BMEI0238          CDS       T00072                                 

Definition
(GenBank) acetyl-coenzyme a synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00010  Glycolysis / Gluconeogenesis
bme00620  Pyruvate metabolism
bme00640  Propanoate metabolism
bme00680  Methane metabolism
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEI0238
   00620 Pyruvate metabolism
    BMEI0238
   00640 Propanoate metabolism
    BMEI0238
  Energy metabolism
   00680 Methane metabolism
    BMEI0238
Enzymes [BR:bme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMEI0238
Lipid biosynthesis proteins [BR:bme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMEI0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAL51420
UniProt: Q8YJ48
Position
I:complement(247350..249362)
Genome map
AA seq 670 aa AA seqDB search
MHYAMPDGSIWLQMLKEEIMSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFWAKH
GRRIDWFKPFTKVKNTDFNGDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGDNPY
IDKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHSVVF
AGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVR
RTGGKVSWGRGRDLWYHQEVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGY
LVYASMTHQYVFDYHDGEIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPDQGR
FWEVVDKHHVNIFYTAPTALRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWYYNV
VGDQKCPIVDTWWQTENGGILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQEGVAD
GNLCISDSWPGQMRTVYGDHKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDDVLN
ISGHRLGTAEIESALVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELRKEL
VQHVRKEIGPIATPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADRGVVD
DLIENRQNKK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
gtgcattatgcaatgccggatggttctatttggctgcaaatgctgaaggaggaaatcatg
tcggaaaagctttaccccgtgctgccggaggcaaagaaaaacacgctcatcgacaacgag
acttatctcgaatggtatgaggagagcgtgagcgacccggatggcttctgggccaagcac
ggccggcgtatcgactggttcaagcctttcaccaaggtcaagaacaccgatttcaacggc
gatgtaacgatcaagtggtatgaggatggcgtcaccaacgtctcatataattgcatcgac
cgccatctgaagagccgcggcgacaaggtcgccatcatctgggaaggcgacaacccctat
atcgacaagaagatcacctatcgcgagctttacgagaatgtctgccgcatggcgaatgtg
ctcaagaagcatggggtgaagaagggcgaccgcgtcacgatctatctgccgatgatcccg
gaagccgcctatgccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtcgtcttt
gccggtttctcgccggaggcgctcgctggccgcatcgttgactgcgaatccactttcgtc
atcaccgccgatgaaggtgtgcgcggcggcaagcctgttgcgctgaaggaaaacaccgat
accgccatcgacatcgccgccaagcaatatgtgatggtcaacaaggtgctggtcgtgcgc
cgcaccggcggcaaggtaagctggggccgcggccgcgatctgtggtaccatcaggaagtc
gcaagcgtcgaaccgcattgcgaaccggaaccgatgaatgcggaagacccgcttttcatt
ctctacacatccggttccaccggcaagccgaagggtgtgctgcataccaccggcggctac
ctcgtctatgcctcgatgacgcatcaatatgtcttcgattaccatgatggcgagatctac
tggtgcacggcggatgtgggttgggtaacgggccactcctatatcgtctacggaccgctg
gccaatggcgcgacaacgctgatgtttgaaggcgtgcccaacttccccgatcagggccgt
ttctgggaagtcgtcgacaagcaccatgtcaatatcttctacaccgcgccaaccgcgctg
cgcgcgcttatgggcgcgggcgatgaattcgtaacccgctcatcgcgttcgacgctgcgc
ctgctgggctcggtcggcgagccgatcaatccagaggcctgggagtggtattacaatgtc
gtgggcgaccagaaatgccccatcgtcgatacctggtggcagacggaaaatggcggcatc
ctcatcaccccacttcccggcgcgaccgatttgaaacccggttcggcaacacgcccgttc
ttcggcgtcaagccggtgctggtggacaatgaaggcaatgtgcaggagggcgtagccgac
ggcaacctgtgcatctccgactcctggccgggccagatgcgcaccgtctatggcgaccac
aagcgtttcatcgaaacctacttctccacctataaggggatgtatttttcgggcgatggc
tgccgccgcgacgaggacggctattactggatcaccggccgcgtcgatgacgtgctgaat
atttccggccatcgcctcggcacggcggaaatcgaatcggcacttgtctcgcatcactcg
gtttcggaagccgccgtggtcggctatccgcacccgatcaagggacagggcatctattgc
tatgtcacgctgatgaccggcgcagacgcgcaggacccggacgagttgcgcaaggaactg
gtccagcatgtgcgcaaggaaatcggccccatcgccacaccggacaagatccagtttgcg
cccggactgccgaaaacccgttccggcaagatcatgcgccgcatcctgcgcaagatcgcc
gaagacgagttcggcgcattgggcgacacctcaacgctcgccgatcggggcgtggtggac
gacctgatcgaaaatcgccagaacaagaaatga

DBGET integrated database retrieval system