KEGG   Brucella melitensis bv. 1 16M: BMEI0333Help
Entry
BMEI0333          CDS       T00072                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMEI0333 (ruvA)
Enzymes [BR:bme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BMEI0333 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:341914..342531
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGVIDEIAEDHAVIDVHGVGYVAFCSARTLGNLGGAGEAAILFIETYVREDMIRL
YGFATQLEREWFRLLQNVQGVGAKVALAVLGTLSPSELANAIALRDIAMVSRAPGVGKKV
AERIVTELKNKAPAFAGEASGTIGLKQELGAGAAPAPVADAVSALSNLGYSRDQAANAVA
AALKETGEGADSAKLIRLGLKELSQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagttgaagggcgtgattgacgaaattgccgaggaccatgctgtcatcgac
gtgcatggcgtgggctatgtcgcgttttgttcggcgcgcacgctgggcaatctcggtggc
gcgggcgaggcggccatcctgttcatcgaaacctatgtccgtgaagatatgatccgcctt
tatggatttgccacgcagcttgagcgcgaatggttccgcctgttgcagaatgtgcaaggg
gtgggggccaaggtggctttggcggtgcttggcaccctgtcgccgtccgaacttgccaat
gcgattgcgctgcgcgacattgccatggtttcgcgcgcgccgggcgtcggcaagaaagtg
gcagagcgtatcgttaccgaattgaagaacaaggctcccgcctttgccggtgaggcgagc
ggcacgatcgggctcaagcaggagcttggcgcaggtgcggcgcctgcacccgttgccgat
gcggtttcggcgctttccaacctcggttattcgcgcgatcaggccgccaatgccgtggca
gccgccttgaaggaaacgggcgagggcgccgattcggccaagctgatacggctcggtttg
aaggaactctcgcagtga

DBGET integrated database retrieval system