KEGG   Brucella melitensis bv. 1 16M: BMEI0391Help
Entry
BMEI0391          CDS       T00072                                 

Definition
sugar transport ATP-binding protein
Orthology
K17207  
putative xylitol transport system ATP-binding protein
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
ABC transporters
Module
Putative xylitol transport system
Brite
KEGG Orthology (KO) [BR:bme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BMEI0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:406815..408344
Genome map
AA seq 509 aa AA seqDB search
MTVEIGGSANCRQWRRYIGISARCGGLRKSFGGVAALRDGRLQLRTGSVHALCGGNGAGK
STFLKILMGIHARDGGHIRRRGKEVTYSSPAEALQAGIAIIEQELSPVPHMTVAENIYLG
REPLRRFGGIDFKTMNLNAQKLLDQLEFKIRANQFMMNLSVAQVQLVEIAKALSHDAEVI
FMDEPTSAIGEKEAQQLFAAIERLKASGKGIVYVSHRLSEIFQIADSYTVFRDGSYIDSG
DLGGITRAELIHMIVGRELGEEYIKTNAPTEIPGVEVSGLSAPGKITDISFTAHKGEIFG
IYGLMGSGRSEIFNCLFGLEKASQGTIRLEGEPVTVRRPADAMALGLAFVTEDRKLTGLN
LGDSVRNNICLASLPEMSPHFSMNRRAESAASREMIERFRIKVAHDTMAVSGLSGGNQQK
VVLGKWFLRKPRVLLLDEPTRGVDVGAKQEIYRIICEFAAQGGTVVMVSSEIDEVLGMSD
RIMVMRGGQSVGIYRRAETDAQSLVHLST
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgactgttgaaatcggcggcagcgcgaactgccgccagtggaggagatacattggaatt
tctgctcgatgtggagggctcaggaagtcctttggcggtgttgctgccttgcgggatggg
cggctgcaattgcgtaccggctcggtacatgcgctgtgcggcggcaatggcgcgggcaaa
tccacgtttttgaaaatcctgatgggcattcatgcccgcgatggtggacatatccgccgg
cgtggaaaagaggttacgtattccagccccgccgaagcgttgcaggcgggtattgcgatc
atcgaacaggagctaagccccgttccccatatgaccgtggcggagaatatctatttgggc
agggagccgcttcgccgtttcggtggcatcgatttcaagacgatgaacctcaatgcccag
aagcttttggaccagcttgagttcaagattcgcgccaaccagttcatgatgaacctgtct
gtcgcgcaggtgcagcttgtggaaatagccaaggcgctcagtcacgacgctgaagtcatt
ttcatggacgaaccgacatcggccattggtgaaaaagaagcacagcagctttttgcagcg
atagagcgtttgaaagcgagcggaaaaggcattgtctatgtctcccatcgcctgtcggaa
atttttcagattgccgatagctataccgtgtttcgcgacggcagttatatcgatagcggc
gatctcggtggcatcacccgtgcggaactgatccatatgatcgtcgggcgggaactgggt
gaggaatatatcaagacgaatgcgcctacggaaataccgggcgtcgaggtttccggcctc
agcgcgcccggcaagataaccgacatttcctttaccgcgcataagggcgagatttttggc
atttacgggttgatggggtcaggccgctcggaaatattcaactgtcttttcggattggag
aaagcctcccaaggaacaattcggcttgaaggcgaacccgtcaccgtccggcgccccgcg
gacgccatggctctggggctggcttttgtgacggaagatcgcaagctgaccggcctcaat
ctcggcgacagcgttcgcaacaatatatgccttgccagccttcccgagatgagtccgcat
ttttcaatgaatcggcgtgcggaatcggccgccagcagggagatgatcgagcgtttcagg
atcaaggttgcgcacgacacgatggccgtttcgggcctttccggcggcaaccagcagaag
gtcgtgctcggaaaatggttcctgcgaaagccacgcgttctgctgctcgatgaacccact
cgcggtgtcgatgtgggtgcaaaacaggaaatttatcgcatcatttgcgaatttgccgcc
caaggcgggaccgtcgtcatggtttcttccgagattgatgaagtcctcggcatgtctgac
cgcatcatggtcatgcgtggcggacaatcggtcggcatctaccgcagggcggaaacggac
gcgcagtcattggtgcatctttcgacatga

DBGET integrated database retrieval system