KEGG   Brucella melitensis bv. 1 16M: BMEI0546Help
Entry
BMEI0546          CDS       T00072                                 

Definition
pyrazinamidase / nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BMEI0546
Enzymes [BR:bme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BMEI0546
    3.5.1.-  
     BMEI0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(565966..566721)
Genome map
AA seq 251 aa AA seqDB search
MFKHGKAVPITNAFVIPERAYLPVSQKLDRYKLIGNNKAEHPMIGHALVVIDVQNDFCPG
GALAVERGDEIIPIVNRLIGESENVVVTQDWHPANHSSFASNHSGSRPFDTVNMSYGPQV
LWPDHCVQNSEGAEFHPDLQWWRAQLVVRKGFRIGIDSYSAFFENDHCTPTGLGGYLRER
NIGSLTMVGLATDFCVASSALDAVQQGFQVRVRLDACRGIDLNGSMNIMLEKMKQAGVEL
IDEPVSASHLL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaagcatgggaaagccgtccctatcaccaatgcctttgttataccagaacgtgca
tatttgccggtttcccaaaaactggatagatataagttgatcggcaacaacaaagcggag
catcccatgatcggccatgcacttgtggttatcgacgtccagaatgatttttgccccggc
ggcgccttggccgtcgaacgtggcgatgaaatcatcccgatcgtcaaccgcctgatcggg
gaaagcgaaaatgtcgtggtcacgcaggattggcatccggccaaccattccagcttcgcc
tccaaccactccggcagccgcccgttcgatacggtcaatatgtcttatgggccgcaggtg
ctctggccggatcattgcgtgcaaaatagcgagggggcagaatttcaccccgatctgcaa
tggtggcgtgcacagcttgtcgtccgcaagggtttccgcattggtatcgacagctactcc
gcattttttgaaaatgaccattgcacgccgacgggccttggcggatatttgcgtgaacgc
aatatcggatcattgacaatggttggcctcgccaccgatttctgcgtcgccagttcagcg
cttgatgcggtccagcagggctttcaggtgcgggtgcgactcgatgcctgccgcggtatt
gatctcaacgggtcgatgaacatcatgctggagaaaatgaaacaggctggcgtcgaactg
atcgatgagcctgtttcagcgtcgcatctactctag

DBGET integrated database retrieval system