KEGG   Brucella melitensis bv. 1 16M: BMEI0552Help
Entry
BMEI0552          CDS       T00072                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMEI0552
Enzymes [BR:bme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BMEI0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(571189..572133)
Genome map
AA seq 314 aa AA seqDB search
MSFKIIHHLPAFDGTALPFRCLVAERPCGVVQLCHGLAEHSARYERFASALAGAGYHVYV
QDHRGHGANITSHAPKGMFAPKQGHAVAIKDVRTLNHYIHQTYADLPVVLFGHSMGGLIA
LNYVFDHADTVDAVAIWNSNFDGGAQSAAALALLYMERMLKGSDVPSGILPRLTFRAWGR
SIKGHRTLFDWLSHDPAEVDAYIADPLCGFDASVALWIDIFHMIRRGANNRNFASIPKHL
PFHLIGGAEDPATAGGAAIQRLAERMRRMGFDRVTHNILPATRHESLNEINRDAVTQKFL
NWLMEALPSRATGR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcaaaatcattcaccatctgccagctttcgatggcaccgcactccccttccgc
tgcctcgttgccgaaaggccgtgtggggttgtccagctctgccacggccttgccgaacat
tctgcgcgctatgaacgatttgcttcggcgcttgccggcgcaggctatcatgtctatgtg
caggaccatcgcggccatggcgccaatatcacctcccatgcgccgaaaggcatgttcgcg
ccaaagcagggccatgctgtggcgattaaagatgtgcgaacgctcaaccactatattcac
cagacatatgccgacctgccggtggtgcttttcggccattcgatgggcgggctgattgcg
ctgaattacgtgttcgatcatgccgacacggtcgatgcggtggcaatctggaattcaaac
ttcgacggtggcgcgcaaagtgctgctgcgctggcgcttctttatatggaacgaatgctg
aaaggttcggacgttccaagtggcatcctgccgcggctgactttccgcgcctggggccgc
tccatcaaggggcatcgcacattgttcgactggctctcgcatgaccctgccgaggtcgac
gcctatatcgccgatccgctttgcggcttcgatgccagcgtggcgctatggatcgatatt
tttcacatgatccgccgcggtgcaaataatcgcaactttgccagcattcccaaacatttg
cctttccatctcatcggcggcgcggaagatccggcaaccgccgggggagcggcaatccag
cgattggcagagcggatgcggagaatgggcttcgaccgcgtgacacacaatatattgccc
gcaactcgtcatgagagtcttaatgagataaatcgggatgcggtaacacagaagtttctg
aattggctaatggaagcccttccgtcgcgcgccacgggacgatag

DBGET integrated database retrieval system