KEGG   Brucella melitensis bv. 1 16M: BMEI0609Help
Entry
BMEI0609          CDS       T00072                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bme00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bme00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:635188..635706
Genome map
AA seq 172 aa AA seqDB search
MKKPLVSIVVAASENNVIGQENDMPWRLSTDLKRFKALTLGKPVIMGRRTWQSLGRPLPG
RANIVITRDADFRAEGAEVVGSLEDALALARKFAAEGGVDEICVIGGGQIYVQAMPLADR
LHLTRVLSVIEGDTYFPEINPQDWQLLSSEDVPAGDKDSYPTRYMLYERRVS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaccactcgtttccatcgtcgtggcggcctccgaaaacaatgtgatcgggcag
gaaaacgatatgccatggcgtctttccaccgacctgaagcggttcaaggcgctgactttg
ggcaagccggtcatcatggggcggcgcacctggcagtcgcttggccgtcccctgccgggg
cgggccaatatcgtcattacccgtgatgccgatttccgggcagaaggtgccgaggtggtc
ggttcgctggaggatgcgctagcgcttgcgcgcaagtttgcggcggaaggcggggtggac
gaaatctgtgtgatcggcgggggacaaatctatgtacaggccatgccgcttgccgatcgc
ttacacctgacgcgcgttctctctgtcatcgaaggcgatacatattttcctgaaatcaat
ccgcaggactggcaattgctttcgagcgaggatgtgcccgccggtgacaaagacagctat
ccaacacgctatatgctgtacgaaaggcgcgtttcgtaa

DBGET integrated database retrieval system