KEGG   Brucella melitensis bv. 1 16M: BMEI0837Help
Entry
BMEI0837          CDS       T00072                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMEI0837
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BMEI0837
Enzymes [BR:bme01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BMEI0837
Amino acid related enzymes [BR:bme01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BMEI0837
Transfer RNA biogenesis [BR:bme03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BMEI0837
 Prokaryotic Type
   Other AARSs
    BMEI0837
Prokaryotic defense system [BR:bme02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BMEI0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(861490..862995)
Genome map
AA seq 501 aa AA seqDB search
MRHQKFRNAPLRGICHCFQTGARHSGAIMSKPVITRFAPSPTGYLHIGGARTALFNWLYA
KHCGGKMLLRIEDTDRERSTEAATAAILDGLTWLGLDWDGEAISQFERAPRHREVAEELV
ANGKAYYCYASPEELEEMREKARAEGRPPRYDGRWRDRDPSEAPAGVKPVIRIKAPRDGE
TVVHDAVQGDVRFPNKDLDDFIILRSDGTPTYMHAVVVDDHDMGVTHIIRGDDHLTNAAR
QTIIYNAMGWDVPQMSHIPLIHGADGAKLSKRHGALGVDAYRAIGYLPAALRNYLVRLGW
SHGDDEIMSTEQMIEWFDVKDINKGAARFDFQKLEAINGLYMRSSDDQALFDALVAVLPE
IEGGKELAEALDDKGRAQLLLAMPGLKERAKTLVELADGAKFIFASRPLALDEKAASLLN
DEGRAVLKPVYPVLEAMGEWTAESLDAAIRAHAEAEGLKLGKIAQPLRAALTGRATSPGV
FDVLVVLGREESLARIGDQIG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcggcatcaaaaattcaggaatgcgcctctgcgcggcatttgccactgctttcagacg
ggcgcgcgacatagtggagctatcatgtcgaaaccggttattacccgttttgccccctcg
ccgacgggttatcttcacattggcggagcccgcaccgctctgttcaactggctttacgcc
aagcattgcggcggcaagatgctgctgcgcatcgaagataccgaccgcgaacgttccacg
gaggctgcaacggcagccattctggacggcctgacctggcttggcctggattgggatggc
gaggcaatctcgcagttcgagcgcgcgccgcgccaccgcgaagtggccgaagagctggtt
gcaaacggcaaggcctattattgctatgcaagcccggaagagctggaagaaatgcgcgag
aaggcacgcgccgaaggccgcccgccgcgttatgacgggcgctggcgcgatcgcgatccc
tccgaggcaccggcaggcgtaaagccggtcatccgaatcaaggcgcctcgggatggcgaa
accgtcgtgcacgatgccgtgcagggcgatgttcgcttcccgaacaaggatctggacgat
ttcatcattctccgttcggatggcacaccgacctatatgcacgctgtcgtggtcgatgac
cacgacatgggcgtcacccatatcattcgcggcgacgaccatctcaccaacgccgcgcgc
cagacgatcatctataatgccatgggctgggacgtaccgcagatgtcgcatatccccctc
atccatggcgccgatggcgcaaagctttccaagcgtcacggcgcgcttggcgtggatgcc
tatcgggccataggctatctgccggccgccctgcgcaactatctcgtccgcctcggctgg
agccatggcgacgacgaaatcatgtcaaccgaacagatgatcgaatggttcgatgtgaag
gacatcaacaagggcgctgcccgctttgatttccagaagctggaggcaatcaacggtctt
tatatgcgttcaagcgacgatcaggcgctgtttgatgcgctcgttgccgttttgccggaa
attgaaggcggcaaggagctggccgaagccctggacgacaaaggccgcgcacaacttctg
ctcgctatgccggggctgaaggagcgcgcaaagacgcttgttgagcttgccgatggtgca
aagttcatttttgccagccgcccgctcgcgctggacgaaaaagccgcatccttgctcaac
gatgaaggccgcgctgtactgaagccggtctatcctgttctggaagcaatgggcgaatgg
acggctgaatcgcttgatgcggcaatccgcgcccatgcggaagccgaagggctgaaactt
ggcaagattgcgcaacccttacgcgccgccctgactgggcgcgccacttctccgggtgta
ttcgacgtattggtggtgcttggaagagaggaatccctcgcccgcatcggcgatcaaatc
ggttaa

DBGET integrated database retrieval system