KEGG   Brucella melitensis bv. 1 16M: BMEI0846Help
Entry
BMEI0846          CDS       T00072                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00010  Glycolysis / Gluconeogenesis
bme00051  Fructose and mannose metabolism
bme00562  Inositol phosphate metabolism
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01200  Carbon metabolism
bme01230  Biosynthesis of amino acids
Module
bme_M00002  Glycolysis, core module involving three-carbon compounds
bme_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEI0846
   00051 Fructose and mannose metabolism
    BMEI0846
   00562 Inositol phosphate metabolism
    BMEI0846
Enzymes [BR:bme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMEI0846
Exosome [BR:bme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMEI0846
  Exosomal proteins of bladder cancer cells
   BMEI0846
  Exosomal proteins of melanoma cells
   BMEI0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAL52027
UniProt: Q8YHF5
Structure
PDB: 

Jmol
Position
I:872392..873156
Genome map
AA seq 254 aa AA seqDB search
MTPGIRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEG
ETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAA
WAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPIWAIGTGLTP
TVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLK
AADFLAICETYRNL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactccgggaatccgtccgctggttgctggcaactggaaaatgaatggcaagggagaa
tccctgaccgaactgcgcgccatcgctgcgggcctcagctccgacctcggccgcaagctc
gatgcggtcatatgtgtgccggccaccttgctttcgcgtgcggctgaaacgctggaaggc
gaaacggtcggccttggcggacaggatgcccatttcaagacatccggcgcgcatacgggc
gacatttcgccggaaatgctcaaggaagctggtgccacccatgtcattctcggccattcc
gagcgccgcaccgatcatcacgagagcaataagctcatttgcgccaagacggaagccgca
tgggctgcggggctggtggctatcgtctgcgttggagaaaccgccagcgagcgaaaggcg
gagcgtgcgctcgatgtcattggcgaccagctttccggttcgctgccggatggggttacg
gcggaaaacacaatcattgcctatgaacccatatgggctatcggcaccgggttgacgccg
acggttcaggatgttcgtgcagcgcacgccttcatgcgtgaacagttgatcgaacgtttc
ggcgcaaaaggcgcgcatctgcgccttctttatgggggttcggtgaagccgtccaatgct
gccgaattgctcggtgttgcagatgttgacggcgctcttgtcggcggtgcgagtttgaag
gcggcagacttcctcgccatatgcgaaacctatcgcaatctataa

DBGET integrated database retrieval system