KEGG   Brucella melitensis bv. 1 16M: BMEI1114Help
Entry
BMEI1114          CDS       T00072                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00010  Glycolysis / Gluconeogenesis
bme00071  Fatty acid degradation
bme00350  Tyrosine metabolism
bme00625  Chloroalkane and chloroalkene degradation
bme00626  Naphthalene degradation
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEI1114
  Lipid metabolism
   00071 Fatty acid degradation
    BMEI1114
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMEI1114
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMEI1114
   00626 Naphthalene degradation
    BMEI1114
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMEI1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 PALP adh_short TrkA_N NADH_4Fe-4S MAF_flag10 Limkain-b1 CMAS
Motif
Other DBs
NCBI-ProteinID: AAL52295
UniProt: Q8YGP4
Position
I:1158808..1159836
Genome map
AA seq 342 aa AA seqDB search
MRALQLLDDRRLEITDIAPPPLPGMGEVTVRIKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVDAVGPGVSNLLPGQLVSIYGARTCGLCRACREGRDNLCEHVGGVHGFHLDGFA
CEAVNLPARLLVAAPPGVDAIGAAVAPVTFGTVEHMLFDNAKLEPGETVLVQAGGSGIGT
AAIQLAKKMGCTVITTVGSNDKIEKAKALGADHVINYREDRFEGVVRKLTKKKGVDVVFE
HVGADTWAGSMLCMKRGARLVTCGSTSGVSTNMNLMQLFQQQLKIFGSFGCRMENMADAM
QKMARGIVHPVIDTVVGFSDIDTALKRMEGRDVFGKIILQID
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttgcagcttctcgatgatcgccgccttgaaatcaccgatattgcgcccccg
ccgctgcccggcatgggggaagtgaccgttcgcatcaaggccgtggcgctcaaccatatc
gatgtctggggctggcgcggcatggcctttgccaagcgcaagatgccgctcgtcatcggt
gcagaggcttccggtgttgtcgatgctgtcggtcccggcgtttccaatctcctgcccggc
cagctcgtttccatctatggcgcgcgcacctgcgggctttgccgcgcctgccgcgaaggc
cgtgacaatctttgcgaacatgtgggcggcgtgcatggtttccatcttgatggctttgcc
tgcgaagcggtgaaccttcccgcccgcctgctggttgccgcccctcccggcgtggatgct
atcggcgcggctgttgctccggtcacattcggcacggtggaacatatgctgttcgacaat
gccaagcttgaacccggcgaaaccgtgctcgttcaggctggcggctcaggcattggcacg
gctgcgatccagcttgcaaagaagatgggctgcacagtcatcaccacagtcggctccaac
gacaagatcgagaaggccaaggctcttggcgccgatcacgtcatcaattaccgcgaggac
cgtttcgagggcgtggtgcgcaagctcaccaagaagaagggcgtggatgtggtgttcgag
catgtgggcgcggacacatgggcaggctccatgctgtgcatgaagcgcggcgcgcgtctc
gtcacctgcggctcgacctcgggcgtttccacgaacatgaacctgatgcagcttttccag
cagcagttgaagattttcggctccttcggctgccgcatggaaaacatggccgacgccatg
cagaagatggcacgcggcatcgtgcatccggtcatcgacaccgtggttggctttagcgat
atcgacacggcgctgaagcgcatggaaggccgcgacgtcttcggcaagatcattctccag
atcgactga

DBGET integrated database retrieval system