KEGG   Brucella melitensis bv. 1 16M: BMEI1469Help
Entry
BMEI1469          CDS       T00072                                 

Definition
(GenBank) guanylate kinase (EC:2.7.4.8)
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BMEI1469
Enzymes [BR:bme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BMEI1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1519715..1520482)
Genome map
AA seq 255 aa AA seqDB search
MLQIERSVDHGYRTGAESGRRSVPRTSTESGVIGIMAISSVENGVARRGLMVVISSPSGA
GKSTIARLLLEDPKMKLSLSISVTTRQRRPSEIDGVHYHFITIREFERLRDNDELIEWAE
VHGNFYGTLRETAEIALADGQDMLFDIDWQGADQLQAKMPADVVSIFILPPTMRELQQRL
NRRAEDTAEVIETRLQNARFEIQKWVKYDYIVINEDLDRSYAAIKSIINAERLRRDRRPG
LFDFVTGLLEEDPGM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgctccaaatcgaacgcagcgtcgatcacggctatcggactggggctgaaagcggtcgt
cgatcagttccgcgaacaagtacagaatctggagtaataggtatcatggccatatcttcg
gttgaaaatggcgtagctcgcagaggcttgatggtggtgatctcgtcgccgtcgggtgcg
ggaaaatccaccattgcccggctgcttctggaagacccgaagatgaagctctcgctctcc
atcagtgtgacgacgcgccagcgtcgcccgagcgagattgacggcgtacattatcatttc
atcacgatccgcgaattcgagcgcctgcgcgacaatgacgagctgatcgaatgggccgaa
gtgcacggcaatttttatggtacgctgcgcgaaacggccgagattgcgctggccgatggg
caggacatgctgttcgatatcgattggcagggggcggaccaattgcaggccaagatgcca
gccgatgtggtgtcgatcttcatcctgccgccgaccatgcgcgaattgcagcagcgtctc
aaccggcgcgccgaagacacggcggaagtgatcgaaacgcgcctgcagaatgcgcgcttt
gaaatccagaaatgggtgaaatacgactatattgtcatcaatgaagacctcgaccgttcc
tatgcggcgatcaagtcgatcatcaatgcggagcggctgcgccgtgaccgccgccccggc
ctgtttgattttgtcacggggcttctggaggaagatccggggatgtga

DBGET integrated database retrieval system