KEGG   Brucella melitensis bv. 1 16M: BMEI1537Help
Entry
BMEI1537          CDS       T00072                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.-)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMEI1537
Enzymes [BR:bme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BMEI1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1583170..1584069
Genome map
AA seq 299 aa AA seqDB search
MTAFQNAGPSITRLAPAKINLALHVTGRRDDGYHLLDMLVVFADQGDRIHIEKAGSDSFT
VSGPFASGIPAGRGNLVLKARDALRQHGGPDLSPVAIHLEKNLPIASGIGGGSSDAAATL
LALNTLWQLDLDFEMLAAIGLSLGADLPMCLHGAAHGTPLIARGIGEELNDVSGIAALPM
LLVNDGTALATPDVFRALTRRENAPLPPPACEGTDALCAYLRETRNDLLPAAISLAPQIE
PKLALLRAKGALYARMSGSGATCFAIFSDKSALTRAAKEIADENPGWFAVPSHSFPSRA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattccagaacgccggaccatcgataacgcgccttgcgcctgcaaagatcaat
ctggcgctgcatgtgaccgggcgacgtgacgacggctatcatcttctcgacatgctggtg
gtctttgccgatcagggcgatcgcatccacatcgaaaaagccggcagcgacagttttacg
gtcagcggcccttttgcaagcggcatccccgccgggcggggcaatctggtgctgaaagcg
cgcgatgcgctgcgccagcatggcgggccagacctttcacctgttgccattcatctggaa
aagaacctgcctattgcttccggcattggcggcggatcgagcgatgcggcagcaaccctg
cttgcgctcaacacgctctggcaactcgatctcgattttgaaatgctggccgctatcggc
ctttccctcggtgcagaccttcccatgtgcctgcatggcgcagcccatggcacaccgctg
atcgcgcgcggcattggtgaagagctgaacgatgtttccggaattgcggcccttcccatg
ctgctcgtcaatgacggtaccgcgcttgccacgcccgacgtgttccgcgcgctcacccgc
cgcgagaacgcccccctgccgcctccggcctgtgaagggacagacgccctttgcgcctat
ctgcgtgaaacacgcaatgatcttctgcccgcagccatcagccttgcaccgcagatcgaa
cccaaactcgccctgcttcgcgccaagggtgcactttatgcgcgaatgtccggctccggc
gcaacatgctttgccatttttagcgataaatcagccctgacacgcgcggcaaaagagatt
gcggatgaaaatccgggctggtttgcagttccttcgcacagctttccttccagagcctga

DBGET integrated database retrieval system