KEGG   Brucella melitensis bv. 1 16M: BMEI1746Help
Entry
BMEI1746          CDS       T00072                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00010  Glycolysis / Gluconeogenesis
bme00071  Fatty acid degradation
bme00350  Tyrosine metabolism
bme00625  Chloroalkane and chloroalkene degradation
bme00626  Naphthalene degradation
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEI1746
  Lipid metabolism
   00071 Fatty acid degradation
    BMEI1746
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMEI1746
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMEI1746
   00626 Naphthalene degradation
    BMEI1746
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMEI1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N AlaDh_PNT_C Glu_dehyd_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AAL52927
UniProt: Q8YEY1
Position
I:complement(1786443..1787564)
Genome map
AA seq 373 aa AA seqDB search
MWQPAVSSPASLMLVSSHSPGTMQVRQRRSNSMAKTMKAAVVRAFGKPLTIDEVPIPQPG
PGQIQVAIQASGVCHTDLHAAEGDWPVKPNPPFIPGHEGVGFVSAVGSGVKHVKEGDRVG
IPWLYTACGHCLGGWETLCEEQLNTGYSVNGGFAEYVVADPNFVGHLPKNIDFNEIAPVL
CAGVTVYKGLKVTDTKPGDWVVISGIGGLGHMAVQYARAMGLNVAAVDIDDRKLDLARRL
GATVTVNAKTVADPAAYIRKETDGGAQGVLVTAVSPKAFEQALGMVARGGTVSLNGLPPG
DFPLSIFNMVLNGVTVRGSIVGTRLDLQESLDFAADGKVKATIQTGKLEDINAIFDDMRQ
GNIEGRIVMDLTQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcagccagcagtttcaagccctgcgtctctcatgcttgtttcttcgcattcccct
ggaacgatgcaagttcgacaacgaaggagtaactctatggcaaagacgatgaaagctgcg
gtcgtgcgtgccttcggcaaaccgctgacgattgatgaagtgccgatacctcaacccggt
cccggccagattcaggttgccattcaggcttccggcgtatgccataccgaccttcatgcc
gccgagggcgattggccggtaaaacccaatccgcccttcattccgggtcatgagggtgtc
ggtttcgtttccgccgtgggcagcggcgtcaagcatgtcaaggaaggcgaccgtgtcggc
attccatggctttacactgcctgcggccattgccttggtggctgggaaacgctttgcgag
gaacagctcaataccggctattccgtcaatggcggctttgccgaatatgtggtggccgat
ccgaatttcgtcggccacttgccgaagaatatcgatttcaacgagattgcgccggtgctc
tgcgcgggcgtgacggtctataagggcctcaaggtcacggatacgaagcccggtgactgg
gtggtcatttcaggcataggcgggctcggccacatggctgtgcaatatgccagggccatg
gggctgaatgttgccgccgtcgatattgacgaccgcaagctcgatctcgcccgcagactt
ggcgcaaccgttacggtcaacgctaagacggttgccgacccggcagcctatattcgcaag
gaaaccgatggcggtgcgcaaggcgtgctggtgacggcggtttcgcccaaggcttttgaa
caggcgctgggcatggttgcgcgcggcggtactgtttcgctgaatggcctgccgcctggc
gatttcccgctttccatcttcaacatggtgctcaatggcgtaacggtgcgcggctccatc
gtggggacgcggcttgatttgcaggaatcgctcgattttgcagccgacggcaaggtcaag
gccaccatccaaaccggcaagctggaagacatcaacgccatcttcgacgatatgcggcaa
ggcaatatcgaaggccgcatcgtgatggacctgactcaatag

DBGET integrated database retrieval system