KEGG   Brucella melitensis bv. 1 16M: BMEI1861Help
Entry
BMEI1861          CDS       T00072                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BMEI1861
Enzymes [BR:bme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BMEI1861
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BMEI1861
Lipid biosynthesis proteins [BR:bme01004]
 Fatty acid synthase
  Component type
   BMEI1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1913061..1913723
Genome map
AA seq 220 aa AA seqDB search
MALFVAAASASAQEEPTGLEDALPTEQLSQVKIVGFGDSLMAGYLLPSNAAFPQQLEKAL
NDKGYEVTVENAGVSGDTTTGGLSRIDWSIPDGTNLVILELGANDALRGIQPDITEKNLD
EMLAKLKARGISVILAGMVAPPNMGKDYAGKFNPIYPRLARKYDVPLYPFFLDGVATRKG
LLLEDGMHPNEKGVETIVANFMPSVEKALKNLQNTGTSGG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttggcactttttgtcgcggccgcaagtgcaagcgcgcaagaagaaccgacaggccttgaa
gatgcgctgcccaccgaacagctctcgcaggtgaagatcgtgggcttcggcgacagcctc
atggctggctatcttctgccgtcgaatgccgcctttccacagcagcttgaaaaggcgctc
aacgacaagggctacgaggtgacggtcgaaaatgcgggcgtatcgggcgacaccacgacc
ggcgggctttcgcgtatcgactggtccattcccgatggtaccaatctggtgatcctggaa
cttggcgcaaacgatgcgctgcgcggcatccagccggatatcacggaaaagaatctcgat
gaaatgctggcaaagctgaaggcgcgcggcatttccgtcatccttgcaggcatggttgcc
cctcccaatatgggaaaagactatgcaggcaaattcaacccgatctatcccaggctggcg
cgcaaatatgatgtgccgctctacccgttcttcctcgacggtgtagcaaccaggaaagga
cttttgctcgaggacggaatgcatcccaatgaaaagggtgtcgaaacgatcgtggccaat
ttcatgccgtcggtcgaaaaggcgctcaagaatttgcaaaacacggggacatcgggcgga
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system