KEGG   Brucella melitensis bv. 1 16M: BMEI1910Help
Entry
BMEI1910          CDS       T00072                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMEI1910 (recR)
DNA repair and recombination proteins [BR:bme03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BMEI1910 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1965030..1965704
Genome map
AA seq 224 aa AA seqDB search
MPHPPKFPFPTPLLPYSLTPLQKMSKRIAGPEIERLIQLLARVPGLGPRSARRAALHLIK
KKEALLVPLGGAMQEAAEKVRICSCCGNVDTSDPCTICTDERRDPATLIVVEDVSDLWAL
ERADTMNVRYHVLGGRLSPLDGIGPDDLNIKGLVERVASGAIKEVILAVNATVEGQTTAH
YITDQLSNFDVRVTRLAHGVPVGGELDYLDEGTLAAALRARTTL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatcctcccaaattcccgttccctacccccttactcccctattcccttactccc
ttacaaaaaatgtccaaacgaatagccggtcctgaaatcgaacgtctgatccagcttctg
gcccgcgtgccggggctcggaccgcgctcggcccgccgtgcggcgctgcatctcatcaaa
aagaaggaagcgcttctggtgccgcttggcggcgccatgcaggaggccgctgaaaaggtg
cgcatctgttcgtgttgcggcaatgtcgatacgtccgacccgtgcacgatctgcaccgat
gagcgccgcgatccggcaactttgattgtcgtggaggacgtatccgatctctgggcgctg
gagcgggcagacacaatgaatgtgcgctatcatgtattgggtggccgcctgtcaccgctc
gatggcatcggcccggacgatctcaacatcaaggggctggtggagcgggttgcaagcggc
gccatcaaggaagtgatcctcgcggtcaacgccactgtcgaaggccagacgaccgcccat
tacatcacagaccagctatcgaatttcgatgtgcgcgtgacacggcttgcccatggcgtt
cccgttggcggcgaacttgactatctggatgaaggcacgcttgctgctgcgttacgggcg
cgaaccacgctttaa

DBGET integrated database retrieval system