KEGG   Brucella melitensis bv. 1 16M: BMEI1961Help
Entry
BMEI1961          CDS       T00072                                 

Definition
(GenBank) polyribonucleotide nucleotidyltransferase
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00230  Purine metabolism
bme00240  Pyrimidine metabolism
bme03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BMEI1961
   00240 Pyrimidine metabolism
    BMEI1961
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BMEI1961
Enzymes [BR:bme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     BMEI1961
Messenger RNA biogenesis [BR:bme03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BMEI1961
Transfer RNA biogenesis [BR:bme03016]
 Prokaryotic Type
  tRNA degradation factors
   BMEI1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH PNPase RNase_PH_C S1 KH_1 Cauli_DNA-bind
Motif
Other DBs
NCBI-ProteinID: AAL53142
UniProt: Q8YEB7
Position
I:complement(2017425..2019569)
Genome map
AA seq 714 aa AA seqDB search
MFNTHKVEIEWGGRPLTLETGKIARQADGAVLATYGETAVLATVVSAKEPKPGQDFFPLT
VNYQEKTYAAGKIPGGYFKREGRPSENETLVSRLIDRPIRPLFVDGYKNDTQVVITVLQH
DLENNPDILSMVAASAALTISGVPFMGPISGARVGYIDGEYVLNPNIDEMPESKLDLVVA
GTSEAVLMVESEAQELPEDVMLGAVMFGHKSFQPVIDAIIKLAEVAAKEPRDFQPEDLSE
LEAKVLAVVENDLREAYKITEKQARYAAVDAAKAKAEEHFFPEGVEETEMSAEQFATIFK
HLQAKIVRWNILDTGNRIDGRDLSTVRPIVSEVGILPRTHGSALFTRGETQAIVVATLGT
GEDEQMIDALTGTYKESFMLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIHPMLPAA
EQFPYTIRAVSEITESNGSSSMATVCGTSLALMDAGVPIVRPVAGIAMGLIKEGERFAVL
SDILGDEDHLGDMDFKVAGTEFGITSLQMDIKIDGITEEIMKVALEQAKGGRVHILGEMA
KAISSSRAELGEFAPRIEVMNIPTDKIRDVIGSGGKVIREIVEKTGAKINIEDDGTVKIA
SSNGKEIEAAKKWIHSIVAEPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADR
VAKTTDVVKEGQKVWVKLMGFDERGKVRLSMKVVDQETGKEIVAEKKKEEVDAE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatacccataaagttgaaatcgaatggggcggacgtccgctcacactcgaaacc
ggcaagattgcccgtcaggctgacggcgctgttctcgccacctatggcgaaaccgccgtt
ctcgcaactgtcgtttctgccaaggaaccgaagccgggccaggacttcttcccgctgacc
gtcaattatcaggaaaagacctatgcagccggcaagattcccggcggctatttcaagcgt
gaaggccgtccgagcgaaaacgaaaccctcgtttcgcgcctgatcgaccgtccgatccgc
ccgcttttcgttgacggctacaagaacgacacgcaggtcgtcattaccgttctccagcac
gatctggaaaacaacccggacatcctgtcaatggttgcggcatctgccgccctcaccatt
tcgggcgtgcctttcatgggtccgatcagcggcgcgcgcgttggttatatcgatggcgaa
tatgtcctgaacccgaatatcgatgaaatgccggaatccaagctcgatctggtggttgcc
ggtacgtcggaagcggttctgatggtcgaatcggaagcgcaggaactgcccgaagatgtc
atgctcggcgccgtcatgtttggccacaagagcttccagccggtgatcgatgcgatcatc
aagcttgccgaagttgccgccaaggaaccgcgtgacttccagccggaagacctgtcggaa
ctggaagccaaggtgctggccgttgtggaaaacgacctgcgcgaagcttacaagatcact
gaaaagcaggcgcgctacgcagccgttgatgccgccaaggccaaagccgaggaacatttc
ttccccgaaggcgtggaagaaaccgaaatgtcggcggaacagttcgcgaccattttcaag
catctgcaggccaagatcgttcgctggaacattctcgacacgggcaaccgtatcgatggc
cgtgacctttcgaccgttcgtccgatcgtttcggaagtcggcatcctgccgcgcacccac
ggttccgcgctcttcacccgcggtgaaacgcaggccatcgtcgttgccacgctcggcacc
ggcgaagacgaacagatgatcgatgcgctgacgggaacctacaaggaatccttcatgctg
cattacaatttcccgccctattcggtcggtgaaacgggccgcatgggttctccgggccgc
cgcgaaatcggccatggcaagcttgcctggcgcgcaatccatccgatgctgcctgccgcc
gaacagttcccctatacgatccgcgctgtttccgaaatcacggaatcgaacggctcttcc
tcgatggcaaccgtttgcggcacctcgctggcgctgatggatgccggtgtgccgatcgtg
cgccccgtcgccggtatcgccatgggtctcatcaaggaaggcgaacgtttcgccgttctt
tccgacattctcggcgatgaagatcacctcggcgacatggacttcaaggtggccggtacc
gaattcggcatcacatcgctacagatggacatcaagatcgacggtatcaccgaagagatc
atgaaggtcgctctggaacaggcaaagggtggccgcgttcacattctcggcgaaatggcc
aaggccatctcctcctcgcgcgctgaactgggcgagtttgccccgcgcatcgaagtgatg
aacattccgaccgacaagatccgcgacgtgattggctccggcggcaaggttatccgcgag
atcgtggaaaagaccggcgccaagatcaacatcgaggacgatggtacggtcaagatcgcg
tcgtcgaacggcaaggaaatcgaagccgccaagaagtggattcactccattgtggctgaa
ccggaagtcggcgaaatctatgaaggcacggtcgtcaagaccgccgatttcggcgctttc
gtgaacttcttcggcccgcgtgacggtctggttcatatctcgcagctcgctgccgaccgt
gttgccaagaccaccgatgtggtcaaggaaggccagaaggtctgggtcaagctcatgggc
ttcgacgaacgcggcaaggttcgcctgtcgatgaaggtcgtcgatcaggaaaccggcaag
gaaatcgttgctgaaaagaagaaggaagaagttgacgctgaataa

DBGET integrated database retrieval system