KEGG   Brucella melitensis bv. 1 16M: BMEII0189Help
Entry
BMEII0189         CDS       T00072                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMEII0189
Enzymes [BR:bme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BMEII0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(200223..200957)
Genome map
AA seq 244 aa AA seqDB search
MLPAYLPKPETGFGKTYVKTNGECKMQMNCDSALLARQSIVDAMRSFEEKGFNHGSSGNI
SVREGGHIWVTPTGATSTMDPQDMSLVSLEGEHLAGKIPSSEWRIHTEIMRAHPEAGAVV
HSHADACVALSCLRKPLPPFHYMIASFGGSEVPCASYRVFGSDALAYEVVRAMGHHRACL
MASHGMVVWGRDLAHARLLAEKLETLARQYILACQIGTPALLSDVELTEVRERYGFYGSQ
PMPR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccagcatatcttcccaaaccggaaaccggttttgggaagacatatgtaaagaca
aatggggagtgtaaaatgcagatgaattgcgattcggcccttttggcccgacagtccatc
gtggatgcgatgcggtcttttgaggaaaagggattcaatcatggcagcagcggcaacatc
agtgttcgggaaggcgggcatatttgggtgacgccaacgggcgcgacctcgactatggac
ccgcaggacatgagccttgtctcccttgaaggcgagcatctggctggcaaaattccctcc
agcgaatggcgtatccataccgaaatcatgcgggcgcacccggaagccggtgccgtggtc
cattcccacgcagatgcctgcgtggcgctttcctgcctgcgcaagccccttccgccattc
cattacatgatcgcttccttcggcgggagcgaggtgccttgtgcgtcatatcgcgtattc
ggatcggacgcgctggcttatgaagtcgtgcgtgcgatggggcaccatcgcgcctgtctg
atggcaagccacggcatggtggtgtgggggcgggatctcgcacatgccaggctccttgca
gaaaagctcgaaacgctggcacggcaatatatattggcctgccagatcggaacacccgcc
ctgttgagcgatgtcgaactgacggaagtccgggaacgctacggtttttacggcagccaa
cccatgccgcgctga

DBGET integrated database retrieval system