KEGG   Brucella melitensis bv. 1 16M: BMEII0396Help
Entry
BMEII0396         CDS       T00072                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMEII0396
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMEII0396
Enzymes [BR:bme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BMEII0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:416622..417617
Genome map
AA seq 331 aa AA seqDB search
MPIRLVHIAKHKWSILIQILEGIQFMHCKILGLPVQEGTGRKGCNMGPDSYRAAGIADAI
RELGHECTDLGNLAPAAQRPLQHPNHAIKALPYAVAWIEAISEAAYRESAEGFPIFLGGD
HLLAAGTVPGIARRAAEKGRKQFVLWLDAHTDFHTLETTTSGNLHGTPVAYYTGQKGFEG
YFPKLAAPIDPHNVCMLGIRSVDPAEREAVKKTEVIVYDMRLIDEHGVAALLRRFLERVK
AEDGLLHVSLDVDFLDPSIAPAVGTTVPGGATFREAHLIMEMLHDSGLVTSLDLVELNPF
LDERGRTAAVMVDLMASLLGRSVMDRPTISY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgccaatccggttggttcacatcgccaagcataaatggtcaattttgatacagatatta
gaaggaatccaatttatgcattgtaagattctggggctgcccgttcaggaaggcactggc
cgcaagggctgtaatatggggcctgattcctatcgtgcggccgggattgccgatgccata
agggaacttgggcacgagtgcacagatttgggcaatctggcgcctgccgcccagcgcccg
ctacagcatccgaaccatgcaatcaaggcgcttccatatgccgttgcctggatcgaagcg
atcagcgaagcggcctatcgcgaaagtgcggaagggttcccgatctttcttggtggcgat
caccttctggcagcgggcacggttcccggtattgcgcgccgcgccgctgaaaaggggcgc
aagcaattcgtgctctggctcgatgcgcatacggatttccatacgctggaaaccacgacc
agcggcaatcttcatggtacgcccgttgcttattataccggtcagaagggctttgagggc
tatttccccaagcttgcagcgccgatcgatccgcataatgtctgcatgttgggcattcgc
agcgtcgatccggctgagcgggaagcggtcaagaaaacagaagttatcgtctatgacatg
cggctgatcgacgagcatggtgttgccgccctgctgcgccggtttctggagcgcgtgaag
gcggaagacgggctgttgcatgtgagccttgatgtcgattttctcgatccctccatcgcg
ccggccgtgggtacgacggtgcctggcggcgcgaccttccgtgaggcgcatctcatcatg
gagatgctgcacgacagcgggctggtgacgagcctcgatctcgtagaactcaatcccttt
cttgatgagcgcggccgcacggccgccgtcatggtggacctgatggcgagccttctgggc
cgcagcgtcatggaccgcccgaccatcagctattga

DBGET integrated database retrieval system