KEGG   Brucella melitensis bv. 1 16M: BMEII0553Help
Entry
BMEII0553         CDS       T00072                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00010  Glycolysis / Gluconeogenesis
bme00071  Fatty acid degradation
bme00350  Tyrosine metabolism
bme00625  Chloroalkane and chloroalkene degradation
bme00626  Naphthalene degradation
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEII0553
  Lipid metabolism
   00071 Fatty acid degradation
    BMEII0553
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMEII0553
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMEII0553
   00626 Naphthalene degradation
    BMEII0553
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMEII0553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AAL53795
UniProt: Q8YCH6
Position
II:complement(577845..579014)
Genome map
AA seq 389 aa AA seqDB search
MTTLTAKWNFPTTVLFGPGHIKELPAVLKAAGIEHPLFVTDPGLAKLPVVASTLAVLDAA
GVQYGVFSDVKPNPVESNLHAGVKVFREGRHDGVIAFGGGSALDLGKLIAFQAGQTRPVW
DFEDIGDWWTRADSNAIAPVIAVPTTAGTGSEVGRAGVLTNESTHTKKVIFHPKMLPVTV
IADPELSTGMPPFITAGTGMDALAHCLEAYCAPGFHPMADGIAVEGIRLVFENLPKAYAN
GGDIEARANMMAAAAMGATAFQKGLGAIHSLSHPIGALYDTHHGMTNAVFMPYVLHHNRA
AIEKRIARLADYLGIEGGFDGFADAIMKLRAELGVPRTLPDLIKNLQMDNARKELIAEMA
VADPTAGGNPVELTKNDALKLLNAALEGR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccacattgaccgcgaaatggaactttccgaccactgtgcttttcgggccggggcac
atcaaggagcttccagccgtcctgaaagccgcaggcatcgagcacccgcttttcgtcacc
gatccgggcctcgccaaactgcctgtggtcgcctcgacattggccgttctggatgcggcg
ggcgtgcaatatggcgtgttttccgatgtgaaacccaatccggtcgagagcaatcttcat
gccggcgtaaaggttttccgggaaggcaggcatgacggcgtcatcgcctttggcggcggt
tccgcgctcgatctcggcaagctcatcgcctttcaggccggacagacccggcccgtctgg
gattttgaagatatcggcgactggtggacccgcgccgacagcaacgccatagctcccgtc
attgccgtgccgaccaccgcaggcaccggctcggaagtggggcgcgcgggcgttctcacc
aatgaatccacccacacgaagaaggtcatcttccaccccaaaatgctgcccgtaacggtg
atcgccgatcccgaactttccactggcatgccgcccttcatcacggcgggtacgggcatg
gatgcactggcgcactgccttgaagcctattgcgcaccgggcttccatcccatggccgat
ggcattgccgtggagggcatccgccttgtctttgagaacctgcccaaagcctatgccaat
ggcggggatatcgaagcgcgtgccaatatgatggcagccgctgccatgggcgccacggcc
ttccagaagggcctcggtgcgatccattcgctctcgcaccccatcggcgcgctctatgac
acacatcacggcatgaccaatgccgtcttcatgccctatgtgctgcaccacaaccgggct
gccatcgaaaagcgcattgcccggctggccgattatctcggcatcgaaggcgggttcgac
ggctttgccgatgcgatcatgaagctgcgcgccgaacttggcgtgccgcgcaccctgccc
gatctcatcaagaaccttcagatggacaatgcccgcaaggagctgatcgccgaaatggca
gtggcagatcccaccgcaggcggaaacccggttgaacttacaaaaaacgacgcgctaaag
ttgctcaatgcagcattggaaggtagataa

DBGET integrated database retrieval system