KEGG   Brucella melitensis bv. 1 16M: BMEII0588Help
Entry
BMEII0588         CDS       T00072                                 

Definition
formate dehydrogenase accessory protein
Orthology
K02379  
FdhD protein
Organism
bme  Brucella melitensis bv. 1 16M
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:622221..623030
Genome map
AA seq 269 aa AA seqDB search
MTNQKISRDVHHLAHRMSGFQESSRIVPEEAPIAMSYNGTTQAVMMATPGDLEDFAIGFS
LTENIVTRIEEIEALDIVAFESGIDIQMKLAKQPEQRLSARRRFMAGQVGCGLCGIDSIE
QALRPLHPLEECSTTFTTRDIAAAVASLGAAQALNAKTHATHGAGFFRPGEGLFAVREDI
GRHNALDKLIGAVAREGLLAEEGIVAITSRVSVEMVQKAVMLGVPVLAAISAPTALAIRT
AEAANLTLVALVRDEEFDIYTHCGRIIEG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccagaagatcagccgggatgtgcaccaccttgcgcatcggatgtcgggtttt
caggaaagcagccgtatcgtaccggaagaagcgccgattgccatgagctataatggcaca
acgcaggccgtgatgatggcgacccccggcgatctggaagatttcgccatcgggttcagc
ctgacggaaaatatcgttacccgtatcgaagaaatagaggcactggatatcgttgctttt
gaaagcggcatcgatatccagatgaagcttgcaaaacagcctgaacagcggctttccgca
cggcgcaggttcatggccgggcaggtcggctgcggcctttgcgggatcgattccatcgaa
caggcgctaaggccgcttcatccgctggaagaatgcagcacgacctttaccacacgcgat
attgcggcggctgtcgcatcgctgggtgcggcgcaggccttgaacgcaaaaacccatgcg
acccatggtgcggggttttttcggccgggtgaggggctttttgccgtgcgcgaggatatc
gggcggcacaatgcgctcgacaagctgattggcgcggtggcgcgggagggcttgctcgcc
gaagaggggatcgtggcaatcacaagtcgcgtttccgtggaaatggtgcaaaaggcagtc
atgcttggggtgccggttctggcggcgatttcggccccgacagcccttgccatccgcacg
gcggaggccgccaatctcaccctcgtcgcactggtgcgcgacgaggaattcgacatttat
acccattgcgggcgtattatagagggttag

DBGET integrated database retrieval system