KEGG   Brucella melitensis bv. 1 16M: BMEII0823Help
Entry
BMEII0823         CDS       T00072                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMEII0823
Enzymes [BR:bme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BMEII0823
Exosome [BR:bme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMEII0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:857090..857257
Genome map
AA seq 55 aa AA seqDB search
MSGYILAIDQGTTSTRSMLFDRNMRVVGLGQQEFTQHFPSSGWVEHDAEEIWKSV
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatatattctggctatcgatcagggaaccacctccacaaggtcgatgctgttc
gacaggaatatgcgggtcgtggggttggggcagcaggaatttacgcagcattttccttcc
tccggctgggtggagcacgatgcggaagaaatctggaaatcggtgtag

DBGET integrated database retrieval system