KEGG   Brucella melitensis bv. 1 16M: BMEII0824Help
Entry
BMEII0824         CDS       T00072                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bme00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:857516..858586
Genome map
AA seq 356 aa AA seqDB search
MLNHVPGLRERAQKGQVCFGTIDSWLIYKLTGGKAHVTDATNASRTLIYHIGENRWDDEL
LDILGIPAAMLPEVKDCAADFGMTDPALFGVSIPILGVAGDQQAAVIGNACFEPGMMKST
YGTGCFALLNTGTDRVTSSNRLLTTIAYRLDGVTTYALEGSIFIAGAAVQWLRDEMGFIS
VASEVSALAEKADPNQRIYLVPAFTGLGAPYWDAEARGAIFGLTRGTGRAEFARAALESV
AYQTFDLLEAMQGDWKGATNHTVLRVDGGMVASDWTMQRLADILNAPVDRPVFLETTVLG
AAWLAASRAGIWPDRKGFSERWQRDCRFEPAMPEKERESAIAGWRDSVSRCLTRPQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaaccatgttccgggcctgcgcgagcgtgcgcaaaaaggtcaagtctgcttcggc
accatcgatagctggctgatctacaagctcaccggcggcaaggcgcatgtaaccgacgcc
acgaatgcctcgcgtacattgatctatcatatcggcgaaaaccgttgggatgatgaactg
ctggacatattgggcattccagccgccatgctgccggaagtgaaggactgcgcggcggat
ttcggcatgacggaccctgcccttttcggcgtttccattcctattctcggcgtagcgggc
gaccagcaggcggcagtgatcggcaatgcctgcttcgagccaggcatgatgaaatccacc
tacggcaccggatgttttgcacttctcaacaccggcacggatcgcgtcacctcctccaac
cggctgctcaccaccatcgcctaccggctcgacggtgttacgacctatgcgctggaaggt
tcgatattcatcgcgggcgcggccgtacaatggcttcgtgacgaaatgggcttcatttcg
gtcgcatcggaagtaagcgcgctggccgaaaaggccgacccgaaccagcgcatctatctg
gttccagccttcaccgggcttggcgcaccctattgggacgccgaagcgcgcggcgcaatc
ttcgggttgacgcgcgggacgggccgcgcagaatttgcccgcgcagcacttgaaagcgtg
gcctatcagaccttcgaccttctggaagccatgcaaggggactggaaaggtgcaaccaat
cacacggtgctgcgcgtcgatggaggcatggttgcttccgactggaccatgcagcgactg
gccgacattctgaacgcacccgtcgatcgcccggtttttcttgaaaccaccgtgctgggc
gccgcatggctggccgcctcccgcgcaggcatctggccggatcgcaagggtttttcggaa
cgctggcagcgtgattgcaggtttgagccggctatgccggaaaaagaacgtgaaagcgcg
attgcgggctggcgggatagcgtttcacgctgcctaacacgaccgcaatag

DBGET integrated database retrieval system