KEGG   Brucella melitensis bv. 1 16M: BMEII0830Help
Entry
BMEII0830         CDS       T00072                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase / dTDP-4-dehydrorhamnose reductase (EC:1.1.1.133 5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BMEII0830
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMEII0830
Enzymes [BR:bme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BMEII0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:863234..863788
Genome map
AA seq 184 aa AA seqDB search
MQKCSNRGQAHAFHSAQHQRRMVHRAGTAKDERGWFARVYCEAAFAERKLETHFPQHSLS
FSREKGTLRGLHYQNEPHSETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVELSAENGVQ
LYIPEGCAHGFQTLTDDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEKPSVISQKDLG
WPFL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatgcagcaatcgggggcaggctcatgcatttcactccgctcaacatcaacgg
cgcatggtccatcgagccggaacggcgaaggacgagcgcggctggttcgcgcgggtctat
tgcgaggcggcctttgccgaacggaagctggaaacacactttccccagcacagcctttcc
ttctcgcgcgagaagggaaccctgcgcggactgcattatcagaacgagccgcatagcgag
acgaaactcgtcacctgcctgcaaggcatcgtctgggatgtgctggtggatcttcgcccc
cattcacccacttatcggcggtgggcgggggtggaactttcagccgaaaacggtgtgcaa
ctctatataccggaaggctgcgcccacggtttccagacgctgacggatgatgtcctcatc
cgctacatgatctcgaagccctatgcgcccgatcatgccgccggcatccgctatgacgat
ccagccctcgacattccatggccggagaagcccagcgtcatttcgcaaaaagatcttggc
tggccgtttctttga

DBGET integrated database retrieval system