KEGG   Brucella melitensis bv. 1 16M: BMEII0908Help
Entry
BMEII0908         CDS       T00072                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMEII0908
   00330 Arginine and proline metabolism
    BMEII0908
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BMEII0908
Enzymes [BR:bme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BMEII0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(948916..949518)
Genome map
AA seq 200 aa AA seqDB search
MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGLAVVTADGQTFKTGDAD
IAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSVIALELHNGKSLSPLVNAG
AIATASLVPGDTADARWNNILECQCGFAGRRLKLSNEVNQSNRRPIFTTAPLPGCFTVPV
LATAIRWRPWIFIRANVQRL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcatcagatgcgatcaaagccgctcttgagaagggacgcgcagcaggcctt
tctgcaaccggcggcaagaatgccgactatattccattcctggcgtcggttccgtccgac
ctgttcggtctggccgtggtgacggcggacggccagacttttaaaaccggcgatgccgat
atcgccttcgctatcgagtcgatttccaaggttttcacccttgccctggttatggaggag
attggtcccgatagtgtgcgggaaaaggtcggtgctgacccgaccgggctgccgttcaat
tctgtaatcgcgctcgaactccataacggcaagtcgctttcgccgctggtcaatgcaggc
gcaattgcaactgcaagccttgttcccggcgatacggcggatgcccgctggaacaatatt
ctggaatgccagtgcggttttgcgggccgccggctcaagcttagcaacgaggtcaaccag
tcgaacagacgaccaattttcacaaccgcgccattgcctggctgctttacagtgccggta
cttgctacagcgatccgatggaggccgtggatatttatacgcgccaatgttcaacgcttg
taa

DBGET integrated database retrieval system